SecReT6
Protein ID: 386710673
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14790
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3101421..3102086 [+]
Producttype VI secretion system protein ImpK
NoteTssL
UniProt IDE0J229
KEGG IDelw:ECW_m3031, ell:WFL_14790
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-48, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|386710673|ref|YP_006174394.1| type VI secretion system protein ImpK [Escherichia coli W]
MKKETDINIDALLRDTFLTVVELRQGTTVRHGMELYRHCQRQVELVRERLKDAGFSRESVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKDPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPVAPERDQLISTLNGLVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLTLLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3101421-3102086 Escherichia coli W chromosome, complete genome
ATGAAAAAAGAGACGGATATCAATATCGACGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATGGAGCTGTATCGTCACTGCCAGCGGCAGGTGGAACTGGTCCG
CGAACGCCTGAAAGATGCCGGGTTTAGCCGGGAGAGCGTGGAGCACATTACCTACGCGCAGTGCGCCCTG
CTGGACGAAACAGTCCTGAGTCGCAGCGGCATGGACGACGGTCAGGCCATCTGGATGAAGGATCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCAGGCGAGCTGCTGTACGAGCGGATGAAGCAGGTGTTGCAGGA
GCCCGCGCCTGCACAGGCTGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGTGGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCTGGTCGCGCCATTTGGCG
TACTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCGTT
TTTCTGGCTGGTAACGCTGACGCTGCTACTGGCCGGTGTCTGGTGGGGGCTGCACCACTGGCTGAACGTG
CTGGTGGATGAATTGCTGCCGCAAAGCCTGCGGTAA