SecReT6
Protein ID: 386710675
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14800
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3103809..3104300 [+]
ProductHcp-like protein
NoteTssD
UniProt IDE0J227
KEGG IDell:WFL_14800, elw:ECW_m3033
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386710675|ref|YP_006174396.1| Hcp-like protein [Escherichia coli W]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNITLDNVKLVRVAPLMHDIKEPSKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3103809-3104300 Escherichia coli W chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGCAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAACAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCCTTTACGTTTACCAAAGAAATCGATGCGTCCAGCCCG
TATCTCTACAAAGCAGTCACCACCGGCCAGACCCTGAAAACGGCGGAATTTAAGTTTTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTACTTCAACATCACGCTGGATAACGTCAAGCTGGTCAGAGTCGCTCCGCT
GATGCACGACATCAAGGAGCCTTCCAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAACGTCCTTCCGCCT
GA