SecReT6
Protein ID: 386710680
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14825
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3111338..3113845 [+]
Producthypothetical protein
NoteTssI
UniProt IDH9Y5B3
KEGG IDell:WFL_14825
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.50E-62, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 1.50E-46, Aligned region: 602..743
T6SS_Vgr [PF13296], Evalue: 7.20E-35, Aligned region: 480..584
Phage_base_V [PF04717], Evalue: 3.40E-14, Aligned region: 392..473
Protein Sequence: 835 a.a.     [Download]
>gi|386710680|ref|YP_006174401.1| hypothetical protein WFL_14825 [Escherichia coli W]
MDILVFDHSYHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDGAFSLTAPPVQ
GMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLHDGATEAVWGLNTAYRVVEKSVSTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDNEAAESGAFYARIRHERYLNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMAPAMAILDGAQSQMQSLSTDAQTTNADPADLSSQIALLQQSVKDLTQAVILLSAPKGVAIASGEHL
QLAASKNVIANAGNNADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAVSVQAQNDLMELLAQKSIEIT
STEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDFNQ
SFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDDIN
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3111338-3113845 Escherichia coli W chromosome, complete genome
ATGGACATACTTGTTTTTGACCACTCGTACCACAAACTCAAAATCCGCGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTCGAAGGCCGCGAACAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGTACCGA
TAAAGCCATCACGCCGGAGTTGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTGCAGGCACCCCTGCGCACCCTGTACGGCGTCATCACCGGCTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTACGGCTTGAACCCCGTATGGCGCTGCTGACCCGCAGCCGCCAGAA
TGCCATTTACCAGAACCAGACTGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCGCGCCTGCTGTCAGAAGTGGGTATCTGGTTCCGCTTCGCCACCGATGCCCG
GCTGAAAATTGAGGTTATCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGTTACACGACGGCGCCACGGAAGCGGTATGGGGACTGAACACCGCGTACAGGGTGG
TGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAACGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCTGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCCATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACAGTGAAGAACGATATTTATGCTCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCGTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCAGGCGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATCCAGAACTACAAGCGCAACGTGCTGCGTACCCCGGCGAACAACAAA
ATCCGCCTCGATGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGAGCCAGT
TGAATCTGGGTCATCTGGTGGATGCCGGAAAACAACAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGGCAG
GTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGCAGTCGCTGTCCACTG
ATGCGCAGACGACGAATGCCGATCCGGCAGATCTGTCATCGCAGATAGCGCTGTTGCAGCAAAGTGTAAA
AGATCTGACGCAGGCCGTGATCCTGCTAAGTGCACCCAAGGGCGTGGCGATCGCCAGCGGCGAGCACCTG
CAACTGGCGGCGTCGAAGAATGTGATAGCGAACGCAGGCAACAACGCAGATATCGGCGTAGTAAAAAATA
TGTTTATCGGTGTGGGTCAGGCGCTGAGCGTGTTTGTGCGTAAAGCGGGCATCAAGCTGTTTGCCAATAA
AGGGGCGGTCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCACAGAAATCGATAGAGATCACC
AGTACGGAAGATGAGATCAAGATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCAGCTACATCC
GGCTGGATGCCTGCGGGATAGAAGCGGGAACGCCGGGAGAATATAACGTTAAGGCCGGATATTACGGGCG
TAAACCAAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAGGATTTTAATCAG
AGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAACTAGAACTGGAAA
GTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTCTGATAAGGAGGA
GGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGACATTAATTAA