SecReT6
Protein ID: 386710685
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14850
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3119668..3121305 [+]
Producthypothetical protein
NoteTssA
UniProt IDH9Y5B8
KEGG IDell:WFL_14850
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 75..135
Protein Sequence: 545 a.a.     [Download]
>gi|386710685|ref|YP_006174406.1| hypothetical protein WFL_14850 [Escherichia coli W]
MRKNTGKTPMSELLQKLTRSCFVDRDALDVARTQAALWQTWLLPVTANTPVGEDPGYHDDFLRIRDEMNK
LSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMN
AVVPQNSSSIPAASSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLVPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LEMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVTIDPVRAAVLCDTQHKE
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3119668-3121305 Escherichia coli W chromosome, complete genome
ATGCGGAAGAATACGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGTCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCAGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AAATACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATCCGCGACGAGATGAACAAA
CTTTCCGGCGCGGATACGGACCTCATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGCT
GGCGCTGCTGGCCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAACA
ACAGTCTCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAAC
GCGGTGGTGCCGCAAAACAGCAGCAGCATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACCTCCGGGCGCGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGAT
GTGGACGGCAAAACCCGGCTGGTCCCGCCGCGCACCGAGTCACGCAATCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACTGGCGTCAGCCATTTCTGGCT
GGACATTCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCGGTT
ATCCGTCAGGACCTGGCGCTTCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCA
CACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CTGCACGACAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACTGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCGGAA
CTGCTGTTTGAGGTAAAAGCCCGGCAACTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCTGATAAAG
CCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTAACAATCGATCCGGTACGGGCAGCGGT
ACTGTGTGATACGCAGCATAAGGAGTGA