SecReT6
Protein ID: 386710697
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14910
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3128348..3130108 [+]
Producttype VI secretion system protein ImpG
NoteTssF
UniProt IDE0IWL1
KEGG IDelw:ECW_m3053, ell:WFL_14910
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-182, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|386710697|ref|YP_006174418.1| type VI secretion system protein ImpG [Escherichia coli W]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGSLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCFYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFECGPLVGDWSQIDLSRLPLYLNAGSPVACALHRALTLGTQQFWLRLPGQDR
RTLDAHFSPLGFEDNDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLELVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDADRMLEDETLSLSLTGTNGHLPR
KALQSTLLDRPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3128348-3130108 Escherichia coli W chromosome, complete genome
ATGGACGACTTAACCCAACGCTACTACGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGGAAAGAATTTG
CGCAGGCTTACCCCGACCGCGCCGCGATGCTCAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
ACGCCTGTTCGAAGGCTTTGCTTTTTTAATGGGCAGCCTGCGCGAGAAGCTGGACGACGATCTGCCGGAG
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCTCACTACCTGCGAACTATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGTTTCTACAGCGCCACGCGGGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGTTCGGTTATTCGTCTGCGCTTTGAATGCGGCCCGC
TGGTCGGTGACTGGTCACAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGGCAGTCCGGTGGC
CTGTGCGCTGCACCGGGCTTTAACGCTTGGTACGCAGCAGTTCTGGTTGCGTCTGCCGGGGCAGGATCGC
CGGACGCTTGACGCACACTTTTCCCCGTTGGGCTTTGAGGATAATGACAGGCTCTGGCCAAAAGGCGAGT
CGGCGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTTGTGGCACT
CAACGGGCTTGAGCTGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAATCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGTCTGCATGACACCTGGCTGATTCTGGGCGGTGATGCGTTTGA
TGCTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCATCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATAGGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCAACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGAACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCTACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA