SecReT6
Protein ID: 386710698
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14915
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3130072..3131151 [+]
Producthypothetical protein
NoteTssG
UniProt IDE0IWL0
KEGG IDelw:ECW_m3054, ell:WFL_14915
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.20E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|386710698|ref|YP_006174419.1| hypothetical protein WFL_14915 [Escherichia coli W]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDNPATDAVRFRPHPGMGFPVSELKNV
ERDAGNPDVPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAMDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPALSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3130072-3131151 Escherichia coli W chromosome, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAACCC
CGCCACCGATGCGGTGCGCTTTCGTCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGCGGGCAATCCCGACGTGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCGCCGCTGCCAACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCTATGGATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTCACGGCACTGGTGGGACTGCTTGCCCCGCTGACGAAAGCGACGGTGGTG
CCTCACGATCCGCAGCCTGTTATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGCACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTACCTGGCGGGCAGCTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGCGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTATCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA