SecReT6
Protein ID: 386710699
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14920
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3131132..3131668 [+]
Producthypothetical protein
NoteTssJ
UniProt IDE0IWK9
KEGG IDell:WFL_14920, elw:ECW_m3055
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.10E-36, Aligned region: 19..168
Protein Sequence: 178 a.a.     [Download]
>gi|386710699|ref|YP_006174420.1| hypothetical protein WFL_14920 [Escherichia coli W]
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLST
MVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPD
EKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3131132-3131668 Escherichia coli W chromosome, complete genome
ATGTTTCCTATTCGTTTTAAACGTCCGGCGCTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGCGGCT
GCGGGCTGATTCAGAAAGTGGTGGATGAATCGAAAAGCGTGGCCTCAGCCGTTTTCTACAAGCAAATCAA
AATACTGCATCTCGATTTCTTCTCCCGAAGTGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACG
ATGGTGCATGTCTGGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTATGACACCCTGTTTATGC
AGGAAGAGAAGACGCTGGAGAAGGACGTACTGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGC
ATCCCTGAATGTGCCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGAT
GAAAAAAGCGACAGCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTG
AACTGATGAGAAGCGACCTGCGACTGCTGCCTCTCAAGGATAAATAA