SecReT6
Protein ID: 386710700
SecReT6 ID639
T6SS typei2
Gene symbol-
Locus tagWFL_14925
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017664] [Browse all T6SS(s) in this replicon]
Location [Strand]3131672..3132100 [+]
Producthypothetical protein
NoteTssE
UniProt IDE0IWK8
KEGG IDelw:ECW_m3056, ell:WFL_14925
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-16, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|386710700|ref|YP_006174421.1| hypothetical protein WFL_14925 [Escherichia coli W]
MSTPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMVAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|386707734|ref|NC_017664.1|:3131672-3132100 Escherichia coli W chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCACTGGAACAGGTCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGTCGGGCAGGCAC
ACTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGTATGGTTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AGTTACTCCCCCAGCCCCGTCCGGGGTATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTGTTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGG
GCGTACTGA