SecReT6
Protein ID: 386743275
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09515
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2033995..2036142 [-]
ProductVgrG-like protein
NoteTssI
UniProt IDI0DTU5
KEGG IDpsi:S70_09515
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.80E-57, Aligned region: 86..378
Phage_base_V [PF04717], Evalue: 2.00E-16, Aligned region: 436..508
DUF2345 [PF10106], Evalue: 0.00015, Aligned region: 541..557
DUF2345 [PF10106], Evalue: 0.00015, Aligned region: 618..657
Protein Sequence: 715 a.a.     [Download]
>gi|386743275|ref|YP_006216454.1| VgrG-like protein [Providencia stuartii MRSN 2154]
MSSNISRKNVSDAEKAGQHWQSLLNRPEPQRLKSASDASGSQPSQSKKIDIYDAIANRKLYSGLVFTCQI
GDLPVETFQVTQFDLHEGLSELFTLNIQAVSSQSEIDFQDVLGMASSITIMREGIVTRCVQGILASAEQG
NTDGVKTWYQFVIRPEMWIMTLKQDSRIFQDTTVPNILETLLNESHVKHDKLFYHPEEHLQRSYITQKRE
TLYEFWCRLAAEEGINYWFEEGPQLFYSDRHLGMKAGIHLTYNPQSETDITDSTVTAWRYAERLCSDIRI
DKDYNQLRPSYPLSHQVTGEVHQQHEVFESYGRFQEDAEGQSFNQIRYEQSQNNRQTGTANTNCIELAPG
RIFSLSNHPSSRMNDSWQVITAHHHGVQPLADNSGGEGTQLSNTITFIPSTQEWRPPYRYKPTADGDELA
TVVGPPGEEIYTNSKGEVIVYFHWDRRGIPDYGASCWVPVSHGWSGNGYGFMSIPHIGQQVLISYLNGDI
DRPIVTGCTYNGSNKPPLDLPKEKTRTTFKTCTHKGEGFNELRFEDQSGQEEVYLHAQRDLNVHIENDSH
WHIQRDSKQRVDQHRYTEIEGDDHSHIKGTQKSLVEGDSSLQVLGSHHQKVNAVMVSESGQETHITSQGK
VVIDAATEITLKVGGSFVRVTPSNVFTSGNVVIGDSAGGTGQAVNIQLPEGVAPFVSPPYPIKPYCAMQA
QATGSWVIKLKGGKA
 
Nucleotide Sequence: 2148 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2036142-2033995 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGTCTTCAAATATCTCGAGAAAAAATGTATCTGATGCTGAAAAAGCGGGTCAACATTGGCAATCTCTAT
TAAACAGGCCAGAGCCACAGCGCCTTAAATCGGCTTCTGACGCCAGCGGATCTCAGCCCTCTCAATCTAA
GAAAATAGATATTTACGATGCAATTGCTAATCGTAAGCTGTATTCCGGACTCGTATTTACCTGCCAAATT
GGTGATCTTCCTGTAGAGACCTTTCAGGTCACCCAATTTGATTTGCACGAAGGGTTATCCGAGTTATTTA
CGCTGAACATTCAAGCCGTCAGCTCACAATCAGAGATTGATTTTCAAGATGTATTGGGGATGGCTTCCTC
CATCACCATCATGCGTGAAGGTATTGTTACCCGTTGTGTACAAGGGATTTTAGCTAGCGCCGAGCAAGGC
AATACCGATGGCGTGAAAACGTGGTATCAGTTTGTCATCCGCCCTGAAATGTGGATCATGACGCTTAAGC
AAGATAGTCGTATTTTCCAAGACACTACCGTTCCCAACATACTAGAAACCTTGCTGAATGAATCCCATGT
TAAACACGATAAATTATTTTATCACCCTGAAGAGCATTTGCAGCGCTCTTATATCACGCAAAAACGTGAA
ACCCTGTATGAGTTTTGGTGTCGCCTCGCTGCCGAAGAAGGGATTAACTACTGGTTCGAGGAAGGCCCAC
AATTATTCTATAGCGATCGCCACTTGGGTATGAAAGCGGGGATCCATTTAACTTATAATCCCCAATCAGA
AACCGATATTACCGACAGCACGGTCACCGCATGGCGTTATGCAGAACGCTTATGTAGTGATATTCGTATT
GATAAAGATTACAATCAGTTACGTCCTTCTTACCCATTGAGCCATCAGGTAACGGGTGAAGTACATCAAC
AACACGAAGTATTTGAAAGTTATGGGCGCTTCCAAGAAGATGCTGAAGGTCAGTCGTTTAATCAAATCCG
CTACGAACAATCGCAAAATAACCGCCAAACAGGCACTGCTAATACCAATTGTATTGAATTAGCACCTGGA
CGAATATTCAGCTTATCTAATCATCCCAGTAGCCGTATGAATGACAGCTGGCAAGTGATTACGGCACACC
ATCACGGGGTACAGCCCCTCGCTGACAACAGTGGCGGTGAAGGTACGCAATTGAGTAATACCATCACCTT
TATTCCAAGTACCCAAGAATGGCGTCCACCGTACCGCTATAAGCCGACTGCTGATGGGGATGAGCTGGCT
ACAGTCGTTGGGCCACCAGGAGAAGAAATTTACACCAACAGTAAAGGGGAAGTTATAGTCTATTTTCATT
GGGATAGACGAGGTATACCTGACTACGGTGCTTCATGCTGGGTACCTGTTTCACATGGTTGGAGTGGTAA
TGGGTACGGATTTATGAGTATCCCACACATAGGTCAGCAAGTCCTTATTAGCTACTTGAATGGGGATATT
GATAGGCCTATTGTTACGGGGTGTACTTATAACGGGAGTAATAAGCCTCCGTTAGATTTACCAAAAGAAA
AAACACGAACGACCTTTAAAACCTGTACTCACAAAGGCGAAGGATTTAACGAACTACGTTTTGAAGATCA
AAGTGGGCAAGAGGAAGTATATCTTCATGCTCAACGTGACCTAAATGTGCATATTGAAAACGATAGCCAT
TGGCATATACAGCGTGATTCGAAACAGCGTGTTGACCAACATCGTTATACAGAGATTGAGGGGGATGATC
ACTCCCATATCAAAGGTACACAAAAATCTCTTGTTGAAGGTGATAGCTCCCTACAAGTACTTGGCAGTCA
TCACCAGAAAGTTAATGCCGTAATGGTTAGTGAAAGTGGTCAAGAAACCCATATCACTAGCCAAGGTAAA
GTGGTAATTGATGCCGCCACAGAAATTACTCTTAAGGTAGGGGGGAGCTTTGTACGTGTGACGCCAAGTA
ATGTGTTTACCTCGGGTAATGTTGTCATTGGTGACAGTGCGGGAGGAACAGGACAAGCGGTTAATATCCA
GTTGCCAGAAGGTGTTGCGCCATTTGTGTCACCACCTTACCCAATCAAACCATACTGTGCGATGCAAGCA
CAAGCAACAGGCAGCTGGGTAATTAAACTTAAAGGAGGGAAAGCATGA