SecReT6
Protein ID: 386743276
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09520
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2036191..2037927 [-]
Producthypothetical protein
NoteTssF
UniProt IDI0DTU6
KEGG IDpsi:S70_09520
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.70E-61, Aligned region: 6..557
Protein Sequence: 578 a.a.     [Download]
>gi|386743276|ref|YP_006216455.1| hypothetical protein S70_09520 [Providencia stuartii MRSN 2154]
MSEIKYLQEKQYLQKLADDYAREKPHLAHVLDPQDPHTGYLLEGFAFLSARLQEKIDDAFPEITLPLLQR
LGSQAIKGLPSTTIIQVDQDGVIDYPYYLSENNLILGPKGASFSLCYGVTLQPYSIVERKITHQPNRSCI
SLRVKYRGIIKEYDTASLNLFLSKQKAIADTLMLGFSQYFDYIELNHDGKSYRGNSLDFYFEPKIGKKFQ
IFQQTDNQLSAPQQLLEGFYLPHVHHFIDINVPLITKQLNWQDDDTFVINIYFNKQLSITQAQCEESFYL
NCVPAIDKEKQNELKIDFKYNQSSYLLPIPDNHYLAHLSDIQLSLEPHEKVRGLYCDFYPMTDFTAASRL
LPQYQQALFYALTIDNDIRGRTLYYLNFYDNKGTPMVVPPSLRFSCNYVSFEQYQESRIGVLNSHSEKVP
EGVKTANITELSNCYPPIVNDKYYWQLLSHYSANAFMLMSLDTIKQMLTEYILYRENDRQVTRKLERLLS
GCIALKTNLYDHILKGKPYRCLSLVVTLDIQKFENEGEAFMFVTHLYHFFPFCLSENMLLEMSVNFNDAD
LPTWYLSPSPLQGYKSLL
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2037927-2036191 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGAGTGAAATAAAGTATCTACAAGAAAAGCAATATTTACAAAAACTCGCTGACGATTATGCGAGAGAGA
AGCCGCATTTGGCTCACGTATTAGATCCACAAGATCCTCATACGGGTTATTTACTTGAAGGGTTTGCTTT
TCTTTCGGCACGCCTACAAGAAAAAATTGATGACGCTTTTCCTGAAATTACCTTACCTTTACTACAACGT
TTAGGCTCACAAGCGATTAAGGGGCTACCTTCAACAACAATTATTCAGGTTGACCAAGATGGGGTCATTG
ATTATCCATATTATCTTTCAGAAAATAATTTGATTCTAGGTCCTAAAGGTGCCAGTTTTAGTCTTTGTTA
TGGAGTGACCCTACAACCTTATTCTATTGTTGAGCGAAAAATTACTCATCAGCCTAATCGGAGTTGTATC
TCATTACGAGTAAAATACCGAGGCATAATAAAAGAATATGATACAGCATCGCTAAACCTCTTTTTGAGTA
AACAAAAAGCTATTGCAGATACTTTGATGCTCGGGTTTAGCCAATATTTTGATTATATAGAGCTGAATCA
TGATGGAAAAAGCTATCGTGGGAACAGCCTTGATTTTTATTTTGAGCCGAAGATAGGTAAAAAATTTCAA
ATTTTCCAGCAAACAGATAATCAATTATCAGCCCCTCAACAGCTACTGGAAGGGTTTTATTTACCACATG
TTCATCATTTTATCGATATTAATGTACCGTTGATCACTAAGCAGCTTAATTGGCAAGATGATGATACGTT
TGTGATCAATATCTATTTCAATAAGCAGCTTTCGATTACTCAGGCACAGTGTGAAGAGAGTTTTTATTTA
AACTGTGTACCTGCAATTGATAAAGAAAAGCAAAATGAGCTGAAAATAGATTTTAAATATAATCAATCGT
CGTATTTATTACCTATACCTGATAATCACTATTTGGCGCATTTATCAGATATTCAGTTGTCATTAGAGCC
TCACGAAAAGGTTCGTGGCTTATATTGTGATTTTTATCCGATGACGGATTTTACTGCGGCATCACGTCTG
CTGCCCCAATATCAACAAGCGTTGTTTTATGCACTCACTATTGATAACGATATTCGAGGAAGGACACTAT
ATTATTTAAATTTTTATGATAATAAAGGTACACCGATGGTAGTGCCTCCTAGTTTACGTTTTTCATGTAA
TTATGTGAGTTTTGAACAATATCAAGAAAGCCGCATAGGGGTCTTAAACAGCCATAGTGAGAAGGTGCCA
GAAGGAGTAAAAACAGCAAATATCACCGAGTTATCAAACTGTTATCCACCGATTGTGAATGATAAATATT
ATTGGCAATTACTATCACACTATAGTGCTAATGCTTTTATGTTGATGTCTCTTGATACTATCAAGCAGAT
GTTGACGGAATATATTTTATATCGTGAAAACGATAGACAAGTTACACGCAAACTTGAACGGTTATTATCA
GGTTGTATTGCGCTTAAAACGAATTTATATGATCACATTTTAAAAGGAAAACCATATCGCTGCTTATCCC
TTGTGGTGACATTAGACATTCAAAAATTTGAAAATGAAGGTGAGGCATTTATGTTTGTCACTCACCTATA
TCATTTTTTCCCTTTTTGTTTATCTGAAAATATGTTGTTGGAAATGTCAGTGAATTTCAATGATGCTGAT
TTACCGACATGGTATTTATCACCCTCACCATTACAAGGATATAAATCACTGTTATAA