SecReT6
Protein ID: 386743277
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09525
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2037947..2038426 [-]
ProductHcp-like protein
NoteTssD
UniProt IDI0DTU7
KEGG IDpsi:S70_09525
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.50E-28, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|386743277|ref|YP_006216456.1| Hcp-like protein [Providencia stuartii MRSN 2154]
MANMIYLTLKGSKQGAISQGCGSLDSIGNKYQNGHEDEIFVLRLGNGFSRTQNINFQPVTLIKLLDKSSP
LLANAIANNETLEMTFNFYRTSQTGSQEKYYTITLREASIINLESDYPHSSNNNEQLPEETLTVKYKDII
FQHVMAGTSGYCSWQENTI
 
Nucleotide Sequence: 480 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2038426-2037947 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGGCGAATATGATCTATTTGACATTAAAAGGCAGCAAACAAGGTGCAATTTCTCAAGGATGTGGAAGTT
TAGACTCGATCGGTAATAAGTATCAAAACGGTCATGAAGATGAAATTTTTGTCCTACGATTAGGAAATGG
CTTTAGTCGTACTCAAAATATTAATTTTCAACCTGTTACATTAATTAAGTTGTTAGATAAATCATCTCCA
CTGTTGGCAAATGCAATTGCCAATAATGAAACACTTGAGATGACATTTAATTTTTATCGGACTTCACAAA
CAGGCTCTCAAGAAAAGTATTACACCATTACTCTGAGAGAAGCGTCCATTATTAATTTAGAGTCAGACTA
TCCTCATTCATCGAATAATAATGAGCAATTACCAGAGGAAACACTAACTGTGAAATATAAAGATATTATA
TTTCAGCATGTTATGGCTGGGACTTCAGGCTACTGTAGTTGGCAAGAAAATACAATTTAA