SecReT6
Protein ID: 386743278
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09530
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2038439..2039770 [-]
Producthypothetical protein
NoteTssA
UniProt IDI0DTU8
KEGG IDpsi:S70_09530
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.70E-47, Aligned region: 89..121
DUF3702 [PF12486], Evalue: 2.70E-47, Aligned region: 169..228
DUF3702 [PF12486], Evalue: 2.70E-47, Aligned region: 284..431
ImpA-rel_N [PF06812], Evalue: 5.30E-19, Aligned region: 42..101
Protein Sequence: 443 a.a.     [Download]
>gi|386743278|ref|YP_006216457.1| hypothetical protein S70_09530 [Providencia stuartii MRSN 2154]
MSTQSENLVIKVGGSPLETPEFIALKTEFNKLNHPARPEVSWTLIESLCLTLFKTHGIDLQSGIYYTIAR
LQLHGLNGFTEGCELLASVVVTQWDHLWPEQPHHRADILNWFNSRAGSALRQISFKTSDLRLIYRSERAL
QLIIDKLAQTTWTKVPKLENLLWFFQNSAKNLEQRENALNQNKGQTVKLPPLVYIQQPKTEQEPPAQSIV
IETAAQKRPSSPMPTQEKMSATKGFFLGLLSSAVIFSGIGYALYYSTQQEVIAMASVPEGAAAQWLYKPE
LTTYADNLGLLEKQSPIFTLKLADSLVDVAKKRWPNNADQAYVSRNWQNLITTRLENAPISDSWSETATL
LQQLSDKIVMQERNRGSFTLSYLKTAIYDIQKQHNKSTPVEERLREFSLQIENDQPISPTLISNIDSQIN
GLLARYYDLQKQAEERGLKPNSY
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2039770-2038439 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGAGTACGCAATCAGAAAACTTGGTGATTAAAGTAGGAGGGTCTCCCTTGGAGACCCCAGAATTTATCG
CGCTAAAAACCGAGTTCAATAAACTTAACCATCCAGCCCGCCCTGAAGTGAGCTGGACTTTAATTGAGTC
ATTGTGTTTAACGCTATTTAAAACCCATGGCATTGATTTACAAAGTGGAATTTATTACACCATCGCGCGT
TTACAATTACATGGTTTAAACGGTTTTACCGAGGGATGTGAACTATTAGCAAGTGTTGTTGTGACACAAT
GGGATCATTTGTGGCCAGAACAGCCCCATCATCGTGCTGATATTTTGAATTGGTTTAATAGCCGTGCTGG
TTCAGCATTGCGGCAAATCAGTTTTAAAACCAGTGATCTACGGTTAATCTATCGTTCCGAGCGTGCGCTA
CAGCTCATTATCGATAAGCTTGCCCAAACAACGTGGACAAAAGTACCGAAATTAGAAAACCTTTTGTGGT
TTTTCCAAAACTCAGCGAAAAACCTCGAACAGCGCGAAAATGCATTAAATCAAAATAAAGGTCAAACGGT
AAAGCTGCCGCCTTTAGTTTATATCCAGCAGCCGAAAACGGAGCAAGAGCCACCAGCACAATCAATCGTG
ATTGAAACAGCGGCTCAAAAACGGCCTTCTTCACCTATGCCTACTCAGGAAAAAATGAGTGCGACAAAAG
GGTTTTTTTTAGGGTTATTATCAAGCGCAGTCATCTTTTCTGGTATCGGCTATGCGTTGTATTACTCGAC
CCAGCAAGAAGTTATTGCAATGGCTTCTGTTCCTGAAGGCGCGGCGGCTCAATGGCTATATAAACCTGAG
CTTACAACCTACGCGGATAACTTAGGGTTATTAGAGAAGCAGTCACCTATTTTTACCTTAAAGCTCGCTG
ATTCATTAGTGGATGTAGCCAAAAAACGGTGGCCTAACAATGCGGATCAAGCTTATGTCAGCCGTAACTG
GCAAAACTTGATAACAACTCGGTTAGAAAATGCGCCAATTAGCGATAGTTGGTCAGAAACAGCGACATTA
TTACAGCAGCTATCAGACAAAATTGTGATGCAAGAGCGCAATCGCGGGAGTTTTACTCTCTCTTATTTGA
AAACTGCTATCTATGATATTCAAAAGCAGCATAACAAGAGTACACCTGTTGAAGAAAGACTACGTGAATT
CTCTTTACAAATTGAAAATGACCAGCCTATCTCACCAACATTAATTAGTAATATCGATTCACAAATTAAT
GGCTTATTAGCACGTTACTATGATTTGCAAAAACAGGCAGAAGAACGCGGTTTAAAACCAAACTCATATT
AA