SecReT6
Protein ID: 386743284
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09560
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2046259..2048874 [-]
ProductATPase
NoteTssH
UniProt IDI0DTV4
KEGG IDpsi:S70_09560
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 278..321
AAA_2 [PF07724], Evalue: 1.60E-37, Aligned region: 606..767
AAA [PF00004], Evalue: 2.20E-20, Aligned region: 221..332
AAA [PF00004], Evalue: 2.20E-20, Aligned region: 612..739
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 324..350
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 346..370
AAA_5 [PF07728], Evalue: 2.90E-13, Aligned region: 611..732
ClpB_D2-small [PF10431], Evalue: 1.70E-12, Aligned region: 515..541
ClpB_D2-small [PF10431], Evalue: 1.70E-12, Aligned region: 773..850
AAA_16 [PF13191], Evalue: 8.20E-11, Aligned region: 7..48
AAA_16 [PF13191], Evalue: 8.20E-11, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 8.20E-11, Aligned region: 263..298
AAA_16 [PF13191], Evalue: 8.20E-11, Aligned region: 471..537
AAA_16 [PF13191], Evalue: 8.20E-11, Aligned region: 587..632
AAA_16 [PF13191], Evalue: 8.20E-11, Aligned region: 677..705
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 469..528
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 610..629
AAA_22 [PF13401], Evalue: 9.40E-07, Aligned region: 673..705
AAA_25 [PF13481], Evalue: 3.00E-06, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 3.00E-06, Aligned region: 606..640
AAA_25 [PF13481], Evalue: 3.00E-06, Aligned region: 782..814
AAA_19 [PF13245], Evalue: 8.00E-05, Aligned region: 217..241
AAA_19 [PF13245], Evalue: 8.00E-05, Aligned region: 605..631
Zeta_toxin [PF06414], Evalue: 0.00018, Aligned region: 220..238
Zeta_toxin [PF06414], Evalue: 0.00018, Aligned region: 610..651
DUF258 [PF03193], Evalue: 0.00022, Aligned region: 184..237
DUF258 [PF03193], Evalue: 0.00022, Aligned region: 612..628
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 212..237
AAA_29 [PF13555], Evalue: 0.00034, Aligned region: 609..636
NACHT [PF05729], Evalue: 0.00051, Aligned region: 220..248
NACHT [PF05729], Evalue: 0.00051, Aligned region: 476..514
NACHT [PF05729], Evalue: 0.00051, Aligned region: 612..640
NACHT [PF05729], Evalue: 0.00051, Aligned region: 816..853
IstB_IS21 [PF01695], Evalue: 0.0018, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0018, Aligned region: 611..623
AAA_17 [PF13207], Evalue: 0.0028, Aligned region: 220..262
AAA_17 [PF13207], Evalue: 0.0028, Aligned region: 612..631
AAA_23 [PF13476], Evalue: 0.0034, Aligned region: 206..533
AAA_23 [PF13476], Evalue: 0.0034, Aligned region: 610..648
Mu-like_Pro [PF10123], Evalue: 0.0067, Aligned region: 449..535
Arch_ATPase [PF01637], Evalue: 0.0081, Aligned region: 200..234
Arch_ATPase [PF01637], Evalue: 0.0081, Aligned region: 273..310
Arch_ATPase [PF01637], Evalue: 0.0081, Aligned region: 612..632
Arch_ATPase [PF01637], Evalue: 0.0081, Aligned region: 682..693
Protein Sequence: 871 a.a.     [Download]
>gi|386743284|ref|YP_006216463.1| ATPase [Providencia stuartii MRSN 2154]
MIQIDLSTLVNRLHPIAKHALESAAAYCVSHQQPEITVSQFLQQLVETPLTDIRLISHKADLDLVALVEL
LEVQIPPHHAITQSYPSFSPLLIEWMKDSWLLASTEYNHSELRSGTLFLTLLQMPLRYLSKPVADLLSQV
NREQLRLNFDSWTAGSAEAPLTEAEKQSGESRPADSLLAKFTQNMTQQARDNQLDPVLCRDHEIDLMIDI
LCRRRKNNPVVVGEPGVGKSALIEGLALRIIAGEIPEKLRGCELLTLDLGALQAGAAVKGEFEKRFKGIM
QEVSQSPHPIILFIDEAHTLIGAGNQQGGLDVSNLLKPALARGELRTIAATTWSEYKKYFEKDAALARRF
QLVQVKEPTAAEAVIIMRGLRSIYEKAHKVFIDDEALRASAELSERYLSGRQLPDKAIDVLDTAGARAAI
NLSSPPKKLSLLKTELHQIGMETDVLQREQQLGLNDHSSRLSALAEQAETINAQVEELQTAWETQQEIVS
QIIALRAQLLDSDQSEELPTNDSLVLKEQLKQLNEQLNELHEQHLLVSPHVDKKQIAAVIAEWTGVPLNR
LSQDALSVVTELPVYLEQTIKGQSLAIECLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVIQIAQ
LMFGGTQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLF
YQAFDKGELADGEGRIIDCKNVAFFLTSNLGDQIITAYADKPDELQDALYPELTAFFKPALLARMEVVPY
LPLSQEILQQIVGGKLARLTSLLEQRFGAEVVVDDSVPTEILRRASRAENGARILESIIDGALLPPLSLL
LLQHSAKNEDINHIQLSTQNDEFVATVNAEL
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2048874-2046259 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGATTCAAATTGATCTTTCGACACTCGTTAACCGTCTTCACCCTATCGCGAAGCATGCGTTAGAAAGTG
CTGCGGCTTATTGTGTGAGCCATCAGCAGCCTGAAATTACGGTATCGCAATTTTTGCAACAACTGGTCGA
AACACCATTGACGGATATTCGCTTAATTAGCCATAAAGCGGATCTGGATTTAGTCGCACTTGTTGAATTG
TTAGAAGTACAAATTCCGCCACATCATGCGATTACTCAAAGCTATCCGAGTTTTTCTCCGTTATTGATTG
AATGGATGAAAGACAGTTGGTTATTAGCCTCGACAGAATATAACCACAGTGAATTACGCTCTGGTACTCT
GTTTTTAACCCTTTTGCAGATGCCATTACGTTATCTGTCAAAACCAGTTGCTGACTTATTATCACAAGTA
AATCGTGAACAACTGCGACTGAATTTTGATAGTTGGACTGCGGGTTCGGCTGAAGCACCACTGACTGAAG
CAGAAAAACAATCTGGAGAGAGTCGTCCTGCGGACTCTTTACTGGCGAAGTTCACGCAAAATATGACTCA
GCAAGCGCGTGATAACCAATTAGACCCTGTTTTATGCCGTGATCATGAAATTGATTTAATGATCGATATC
TTGTGTCGTCGTCGTAAAAACAACCCCGTGGTTGTGGGAGAGCCGGGGGTAGGTAAAAGCGCCCTAATCG
AAGGATTGGCATTGCGTATTATTGCAGGTGAAATCCCTGAAAAATTACGTGGGTGTGAATTACTTACTTT
AGACCTTGGTGCTTTACAAGCGGGTGCTGCGGTCAAAGGTGAATTTGAAAAACGCTTCAAAGGCATTATG
CAGGAAGTGAGTCAATCACCTCATCCTATCATTTTGTTTATTGATGAAGCACATACCTTAATTGGTGCGG
GTAACCAACAAGGTGGATTGGATGTCTCCAACCTATTAAAACCCGCCTTGGCTCGCGGTGAATTACGTAC
TATCGCGGCGACAACATGGAGTGAATACAAAAAGTATTTCGAAAAAGATGCTGCCCTTGCGCGCCGTTTC
CAACTTGTTCAAGTTAAAGAGCCAACGGCGGCAGAAGCAGTCATCATCATGCGTGGCCTACGCTCTATTT
ATGAAAAAGCGCATAAGGTCTTTATTGATGATGAAGCATTGCGTGCGAGTGCTGAGTTAAGTGAGCGCTA
CCTATCAGGTCGCCAACTCCCAGATAAAGCGATTGATGTACTTGATACGGCGGGGGCTCGTGCGGCTATC
AACTTATCTTCACCGCCGAAAAAGCTCTCGTTGCTGAAAACGGAACTTCATCAGATTGGTATGGAAACGG
ATGTGCTACAACGTGAACAACAATTGGGGCTTAATGACCATAGTTCGCGTCTGAGTGCACTAGCTGAACA
GGCTGAAACTATCAATGCTCAGGTTGAGGAGCTACAAACCGCGTGGGAAACCCAGCAAGAGATTGTTTCT
CAAATTATTGCATTAAGAGCGCAGCTACTGGACAGCGACCAAAGTGAAGAGCTTCCAACTAACGACAGTT
TGGTATTAAAAGAGCAGCTTAAACAATTAAATGAGCAATTGAATGAGCTACATGAACAGCATTTATTAGT
CTCGCCACATGTCGATAAAAAACAAATTGCTGCCGTTATTGCTGAATGGACGGGGGTACCTTTAAATCGT
TTATCGCAAGATGCTCTATCAGTGGTAACGGAGTTACCCGTTTATTTAGAACAAACAATCAAAGGGCAAT
CATTAGCGATTGAGTGCTTACATAAGCATTTGTTAACTGCTCGCGCTGACTTACGACGCCCAGGTCGACC
GTTAGGTGCATTTTTATTGGCGGGGCCAAGTGGTGTCGGTAAAACAGAAACGGTTATTCAAATAGCACAA
CTGATGTTTGGTGGAACGCAATATTTAACGACAATCAATATGTCAGAGTTCCAAGAGAAACATACAGTTT
CACGGCTGATCGGTTCACCTCCAGGTTATGTTGGTTATGGTGAAGGCGGCGTACTGACAGAAGCGATCCG
CCAAAAGCCTTATTCTGTTGTTTTATTGGATGAAGTTGAAAAAGCCCATCCTGATGTTCTGAATCTATTC
TATCAAGCCTTTGATAAAGGTGAATTAGCCGATGGGGAAGGGCGAATTATTGACTGCAAAAATGTCGCTT
TCTTCCTAACGTCTAATCTAGGCGACCAAATCATTACTGCCTATGCAGATAAGCCTGATGAGTTGCAAGA
TGCGCTTTATCCGGAATTAACCGCATTTTTCAAACCTGCACTGCTGGCACGTATGGAAGTGGTTCCTTAT
TTACCATTATCTCAAGAGATCCTTCAGCAAATTGTCGGTGGCAAGTTAGCTCGTCTGACTTCGTTACTTG
AACAGCGTTTTGGTGCGGAAGTTGTGGTCGATGACAGTGTACCTACAGAGATCTTACGTCGTGCTTCTCG
TGCGGAGAATGGTGCGCGGATATTAGAATCCATCATCGATGGCGCACTGTTACCACCGTTATCGCTACTG
CTACTACAGCACAGCGCAAAAAATGAAGACATTAATCACATTCAATTATCAACACAGAACGATGAGTTCG
TTGCGACGGTGAATGCTGAACTATGA