SecReT6
Protein ID: 386743285
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09565
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2048883..2049638 [-]
Productputative membrane protein Aec26
NoteTssL
UniProt IDI0DTV5
KEGG IDpsi:S70_09565
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.50E-63, Aligned region: 30..235
Protein Sequence: 251 a.a.     [Download]
>gi|386743285|ref|YP_006216464.1| putative membrane protein Aec26 [Providencia stuartii MRSN 2154]
MTNAAFLNDYAEQGNLQKNYQLPLRGNSINPMIDAATPLLGMVLRMKAMSETPLSEKLYQQVVTDITSIE
QQLQTQGYEPGAIVSFRYVLCTFIDETALGLGWNQDNGWVKQSLLVHFHNESWGGEKVFVLIERLLGEPK
RYLDLLEFIYLCLCLGYRGRYKVTTGHSDEFNHLLRRLQKQIQQLRGEAKPVILFDEGGNKHHRYRLGRR
FGVRYVILGAVILAAIIYSIYSSRLNHQTLSIVEQLNTLLG
 
Nucleotide Sequence: 756 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2049638-2048883 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGACTAATGCAGCTTTCCTTAATGACTATGCCGAACAGGGCAACTTGCAAAAAAATTATCAGTTGCCTT
TGCGGGGGAATAGCATCAATCCAATGATTGATGCTGCGACGCCATTGCTTGGGATGGTTCTCAGAATGAA
AGCGATGTCAGAAACCCCTCTTTCGGAAAAGTTATATCAGCAGGTGGTGACCGATATCACCTCAATAGAG
CAACAACTACAAACCCAAGGTTATGAACCTGGGGCTATTGTTTCATTTCGCTATGTTCTATGCACCTTTA
TTGATGAAACAGCATTGGGATTAGGTTGGAACCAAGACAACGGCTGGGTTAAACAGTCGTTATTAGTACA
CTTCCATAATGAATCTTGGGGTGGTGAAAAGGTTTTTGTATTAATTGAGCGGTTACTCGGTGAGCCTAAA
CGCTATCTCGATTTGCTGGAATTTATCTATTTGTGTTTGTGCCTTGGCTATCGTGGTCGCTACAAAGTGA
CAACAGGGCATAGTGATGAATTTAACCATTTACTCAGACGGTTACAGAAACAGATTCAGCAACTTAGAGG
CGAAGCAAAACCCGTTATCCTTTTTGATGAAGGGGGTAATAAACACCATCGCTACCGTTTAGGCCGGCGC
TTTGGTGTTCGCTACGTCATTCTTGGCGCCGTTATCTTAGCGGCAATTATTTACAGCATTTATTCATCCC
GACTGAATCATCAAACACTCAGTATCGTGGAACAGCTTAATACTTTACTCGGCTAG