SecReT6
Protein ID: 386743286
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09570
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2049631..2050785 [-]
Producthypothetical protein
NoteTssK
UniProt IDI0DTV6
KEGG IDpsi:S70_09570
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.10E-131, Aligned region: 1..378
Protein Sequence: 384 a.a.     [Download]
>gi|386743286|ref|YP_006216465.1| hypothetical protein S70_09570 [Providencia stuartii MRSN 2154]
MPDGTIFSMPHQDILPQPIDIKNISDGDNNIVYLAFPLVNSTVNEVSTEHSGNRLLSRYSDSMEDVRDLH
TEGGDVSTINVAKLRPILKQGSKEMDAYVTLPICKIRERGADGSLTLENDFIPTCLNVRISPMLNEFLNE
IHGALYERGKQIALRIGSPGQQGVADVAEFMMLQVLNRTYPLYSHYAQEPVIHPEKLFRDLLELCGELQT
FTNTSRLPDSVAKYKHFNLSESYIPLIKDIREALSVVLTPRAIPIPLDTQEHGIRVATIHDKQLLQKAEF
IIAVKANMPQEQLRQLFPQQSKISSVSNIRKVVSVQIPGVKLIPLSTAPRQLPYHSGYNYFELDRSGDVW
QEIKQHSNMAFHVSGNFPELDIQLWAVRGGIDND
 
Nucleotide Sequence: 1155 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2050785-2049631 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGCCTGACGGCACGATCTTTTCTATGCCTCATCAAGATATTCTTCCTCAACCTATTGATATTAAAAATA
TTAGTGATGGTGATAACAATATCGTTTACCTTGCATTTCCCTTAGTGAATAGCACGGTCAATGAAGTGTC
GACTGAACATAGTGGTAACCGCTTGTTATCACGTTATAGCGACAGTATGGAAGATGTTCGCGACCTGCAT
ACGGAAGGTGGGGATGTCAGTACGATCAATGTGGCCAAATTAAGACCGATTCTGAAGCAAGGCTCCAAAG
AGATGGATGCTTATGTCACTTTGCCTATTTGTAAAATTAGGGAACGTGGTGCTGATGGCAGCTTAACACT
TGAGAATGACTTTATTCCGACATGTTTGAATGTGCGTATCTCACCAATGCTAAATGAGTTCCTGAATGAA
ATTCATGGTGCTTTATATGAGCGTGGTAAACAAATTGCGTTACGTATTGGCTCCCCAGGGCAACAAGGTG
TCGCGGATGTAGCAGAATTTATGATGTTGCAGGTATTAAATCGTACCTATCCATTGTATTCGCATTATGC
GCAAGAGCCGGTTATTCATCCGGAAAAACTGTTTAGAGATTTGCTCGAATTGTGTGGTGAATTACAAACG
TTCACTAATACCTCTCGTTTACCTGATTCTGTGGCTAAATATAAACATTTCAATTTATCTGAAAGCTATA
TCCCACTCATCAAAGATATTAGGGAAGCACTGAGTGTGGTGTTAACACCTCGCGCAATTCCAATTCCATT
AGATACGCAAGAGCACGGTATTCGTGTTGCGACGATCCATGATAAGCAGTTACTGCAAAAAGCAGAATTT
ATTATTGCGGTCAAAGCGAATATGCCACAAGAACAGTTACGTCAACTGTTCCCACAACAATCGAAGATCT
CTTCAGTGAGCAATATTCGTAAAGTGGTCAGCGTGCAGATCCCAGGTGTGAAATTGATTCCATTATCAAC
GGCACCACGTCAATTACCTTATCACTCTGGTTATAACTACTTCGAATTAGATAGAAGTGGCGATGTTTGG
CAGGAAATTAAGCAGCACTCCAATATGGCATTCCACGTTTCTGGCAATTTCCCTGAGCTTGATATTCAAC
TTTGGGCGGTAAGAGGCGGAATAGACAATGACTAA