SecReT6
Protein ID: 386743287
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09575
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2050835..2050990 [-]
Producthypothetical protein
NoteTssK
UniProt IDI0DTV7
KEGG IDpsi:S70_09575
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 51 a.a.     [Download]
>gi|386743287|ref|YP_006216466.1| hypothetical protein S70_09575 [Providencia stuartii MRSN 2154]
MSTKNRVIWREGLFIKPQHFQQQQRHQDYITESILKSYISHFLGAQFVNSE
 
Nucleotide Sequence: 156 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2050990-2050835 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGTCGACAAAAAATAGAGTGATTTGGCGTGAAGGTTTATTTATTAAGCCTCAGCATTTTCAGCAGCAAC
AGCGTCATCAAGACTATATTACTGAAAGCATACTGAAGAGCTATATTTCTCATTTTTTGGGGGCTCAGTT
CGTTAATTCTGAGTGA