SecReT6
Protein ID: 386743288
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09580
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2051042..2051545 [-]
Productlipoprotein
NoteTssJ
UniProt IDI0DTV8
KEGG IDpsi:S70_09580
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-32, Aligned region: 17..160
Protein Sequence: 167 a.a.     [Download]
>gi|386743288|ref|YP_006216467.1| lipoprotein [Providencia stuartii MRSN 2154]
MRAKTLLGYLFLLFSMMALSGCTKPLEAVSKIGQVILDPSIPIGPPQDRPSTISLTILAEPNINPNQDGE
ATPLNLQIVYMNEDSLFAALDFDQIEEKDGDLEKVLKKNYIDHQDYTILPGQYKPLPDIELYPDNRYIGV
IGYYSDPDNAEWKKLLRHVEKDAITSS
 
Nucleotide Sequence: 504 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2051545-2051042 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGCGTGCGAAAACCTTACTAGGATACCTATTTTTACTCTTTTCAATGATGGCGCTTAGTGGATGTACTA
AGCCATTGGAAGCTGTATCCAAAATAGGTCAAGTCATATTAGACCCTTCGATTCCTATCGGGCCGCCACA
AGATAGGCCATCAACGATATCGTTGACTATCTTGGCTGAGCCCAACATCAACCCAAATCAGGATGGTGAA
GCAACGCCACTGAATCTACAGATTGTCTACATGAATGAAGATTCATTGTTTGCTGCGCTCGATTTTGACC
AGATTGAAGAGAAAGATGGGGATCTCGAAAAGGTACTGAAAAAAAACTATATCGACCATCAGGACTACAC
CATTTTACCTGGGCAATACAAGCCGCTACCTGACATTGAGCTATATCCAGACAATCGTTATATCGGGGTC
ATTGGTTACTACTCAGACCCTGATAACGCGGAATGGAAAAAATTGTTAAGGCACGTGGAAAAGGACGCCA
TTACTTCCTCCTAG