SecReT6
Protein ID: 386743289
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09585
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2051547..2052818 [-]
Productphosphopeptide-binding protein
NoteFha
UniProt IDI0DTV9
KEGG IDpsi:S70_09585
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-07, Aligned region: 35..100
Protein Sequence: 423 a.a.     [Download]
>gi|386743289|ref|YP_006216468.1| phosphopeptide-binding protein [Providencia stuartii MRSN 2154]
MDKYLPTISFRLINSELLESGYVSSMTFSQDGGQIGSSAQCQWQIQDNQNSVAPVQCTILWKDKHFCIKT
NTESVYVNNAIVPLHLDAVRLAHGDQIKIGQLKLSVNVNLTGQPAEDLMAVTPQSLVSSDSNPLDSLFNT
TPTQSYEQEEYELAPTVQGSLTYDPLQALENESLSLISQKNKQASDPLLMNEAHLTHSVTSPFSDNQGNT
MVQEFMDLPKITPTLDDTITDIEHVAVNPLMQGLGIHLNLQTSQQANDFLVELGKTIRSAIEGLLALQQQ
QESLQDKQLRPIEDNPLRLNSSYEETMKLMFTDERSPVHLSAPSAVAESLHNIQLHYRANQEAISTALST
MLAAFSPEHLLNRFAHYRRASDNSSTNDAWAWEMYTNYYKELSSSRQQGFEKLFYEVYTHAYDRALRKGL
EEA
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2052818-2051547 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGGATAAGTATTTACCGACAATTTCATTTCGCCTGATTAATAGTGAATTACTCGAAAGCGGTTATGTTT
CGAGTATGACATTTTCACAAGATGGCGGGCAAATAGGCAGTAGCGCACAGTGCCAGTGGCAGATTCAAGA
TAACCAAAATTCCGTGGCACCAGTGCAATGCACTATTCTTTGGAAGGATAAGCACTTTTGCATTAAGACC
AATACAGAATCAGTTTATGTCAATAATGCGATTGTACCTCTTCATCTTGATGCGGTACGGCTTGCTCATG
GTGACCAGATCAAAATTGGTCAGCTTAAATTGTCTGTTAATGTGAATCTTACTGGACAACCAGCAGAAGA
CTTAATGGCTGTCACCCCTCAATCACTGGTTTCTAGCGATAGTAATCCATTAGATTCTCTATTTAATACC
ACACCGACTCAATCTTATGAGCAAGAGGAGTATGAGCTTGCTCCGACCGTTCAAGGGTCCCTAACGTATG
ATCCGCTTCAAGCCTTAGAAAATGAGAGTCTTAGCTTAATTTCTCAGAAAAATAAGCAAGCTTCAGACCC
ATTATTAATGAATGAAGCACACTTAACGCACTCAGTCACCTCCCCATTTTCAGATAATCAAGGGAATACC
ATGGTTCAGGAATTTATGGATTTACCAAAAATCACACCAACACTTGATGACACTATCACAGACATTGAGC
ATGTGGCTGTAAACCCTTTAATGCAAGGGCTTGGTATTCATTTAAATTTACAAACTTCACAACAAGCGAA
CGATTTTCTAGTGGAGCTAGGGAAGACTATTCGCTCCGCCATCGAAGGTTTATTGGCATTACAGCAACAG
CAAGAAAGCCTGCAAGATAAGCAACTTAGACCAATTGAAGATAACCCATTGCGTTTAAACAGCAGTTATG
AAGAAACAATGAAGTTGATGTTTACGGACGAACGTAGTCCCGTTCATTTATCAGCCCCTTCAGCGGTAGC
AGAAAGTTTGCATAACATTCAGTTGCATTATCGAGCAAACCAAGAAGCTATTTCGACGGCACTTTCAACG
ATGTTGGCTGCTTTCTCTCCTGAACACCTTTTAAATCGTTTCGCGCACTATCGCCGTGCTTCAGATAACT
CTTCGACAAACGATGCTTGGGCATGGGAAATGTACACCAACTACTATAAAGAGCTGTCATCTTCTCGCCA
GCAAGGTTTTGAAAAGTTGTTCTATGAAGTCTATACCCATGCCTATGACAGAGCCTTAAGAAAAGGGCTT
GAGGAAGCATAA