SecReT6
Protein ID: 386743290
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09590
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2052824..2053861 [-]
Producthypothetical protein
NoteTssG
UniProt IDI0DTW0
KEGG IDpsi:S70_09590
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.20E-87, Aligned region: 24..332
Protein Sequence: 345 a.a.     [Download]
>gi|386743290|ref|YP_006216469.1| hypothetical protein S70_09590 [Providencia stuartii MRSN 2154]
MASTNQSANTEVIARWLDEAGNSVTEYSFYQLVELLNKLQGKSTTTQETTDEIIRFKSCANIAFPTRDVI
SVKKNQNGKFELEVSFLGLHGSQSPLPSYYLDDFAWEDAQQQPSVTDYLNLFNHRLVTLLHRIWRKYRYY
ICFENEGVDSFSRYMFSLVGLGNEVNRERVHINHSKMLAYAGLLASPSRSPDVISSLIAHCFDLEHVEVI
GWETRKVPIPENQQNRLGVISHQAGKKSQPRMLLGDNFSLGGHIYDCNGKCTVEISELSLERYMSFLPNG
ANFLPLVAFVSYIFHEQLAWDLRLNIAEKQAEGIRLGQKQHNQLGWQSFLGKPEKQPNVTITVLE
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2053861-2052824 Providencia stuartii MRSN 2154 chromosome, complete genome
GTGGCCAGCACAAATCAATCAGCAAATACTGAAGTGATAGCGCGCTGGCTAGATGAAGCTGGCAATTCTG
TTACTGAATATAGTTTTTATCAACTTGTTGAACTACTTAATAAGTTACAAGGTAAAAGCACAACCACGCA
GGAAACAACGGATGAAATAATTCGTTTTAAGTCCTGTGCAAATATTGCTTTTCCTACGAGAGATGTCATC
TCGGTCAAAAAGAATCAAAACGGGAAGTTTGAGCTTGAAGTCTCCTTCTTGGGGTTACACGGTAGTCAGT
CTCCGTTACCGAGCTATTATCTGGATGATTTTGCTTGGGAAGATGCCCAACAACAACCTAGCGTGACAGA
TTATTTGAACCTTTTTAATCACCGTTTAGTCACGCTTTTACATCGTATTTGGCGTAAATACCGTTACTAC
ATTTGCTTTGAAAATGAGGGAGTTGATTCATTTTCTCGCTATATGTTTTCGTTGGTTGGCTTAGGGAATG
AAGTCAACAGAGAAAGAGTTCATATCAATCACAGTAAGATGTTGGCCTACGCTGGGCTTTTAGCGAGTCC
AAGCCGTTCTCCCGATGTTATCAGTAGTTTAATTGCCCACTGTTTCGATCTCGAACACGTTGAAGTTATC
GGTTGGGAAACTCGTAAAGTACCTATTCCTGAAAATCAACAAAATCGGTTAGGTGTGATTTCTCATCAGG
CTGGGAAGAAATCGCAGCCCCGTATGTTATTGGGCGATAACTTTAGTTTGGGCGGGCATATCTATGATTG
TAATGGCAAATGTACCGTCGAAATCAGTGAATTATCACTCGAGCGTTATATGTCCTTTCTGCCTAATGGA
GCTAATTTTTTACCTCTTGTCGCTTTTGTCTCTTACATCTTCCATGAGCAGTTGGCATGGGACTTACGGC
TCAATATTGCTGAAAAACAAGCTGAAGGGATCCGTTTAGGCCAGAAACAACACAATCAATTAGGGTGGCA
AAGCTTTTTAGGTAAACCTGAGAAACAACCTAATGTCACCATTACTGTACTGGAATAA