SecReT6
Protein ID: 386743291
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09595
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2053825..2055606 [-]
Producthypothetical protein
NoteTssF
UniProt IDI0DTW1
KEGG IDpsi:S70_09595
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-150, Aligned region: 5..592
Protein Sequence: 593 a.a.     [Download]
>gi|386743291|ref|YP_006216470.1| hypothetical protein S70_09595 [Providencia stuartii MRSN 2154]
MSSNPYFANEQEYLKELASHIAIEKPHLVDLLSNKIQDPDGARLMDGLAYLSGNLREQLDRQFSELTSSL
VNMLWPAYARPFPSMTIVEYQTDAQTLSYASKIAAGQPFVAKPLYVQGETPNADSLHQCRFSQCRDLWLL
PAKISHVRQRTKSIEIDFKLDKPRVLAEIGLDKLRIHLNGATYTTHQLFYLLSHRIKQVTLVTEHHRLPL
DNFAALPVGFKKEDALLPYPKNSYDGYRILQEYFCFPEAFMFMDIKGLEDLPLALNTDSFTLEIVFETEI
PDAVVIRDDSIKLNCVPIANLFTIDSEAIDLTGKNDDYILSASYRTPLCYDIFSINQVQGLRYPQNASPY
AVNYTAFESFHHQSHNLKDKNHGYYRLKINQMREAVGYRHTLSFVRDNETKLQNCEETVSVSLNCTNRNV
ASRLSTHSISLDKAYRPEGALSATNLFKPTAPLYPLLGQTLYWSELTNLSLNYQSLLNLTSLKQILQLYD
LPSVFNRQTARQSQQCLDSLISLNTEHIEHLYRGLPVRGLKTTLTVRQSAFLSEGSLYLFCTVIAQFFAL
YTSVNMFHELEVINIDNKETYRWPAQINQQILK
 
Nucleotide Sequence: 1782 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2055606-2053825 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGTCTTCAAACCCGTATTTTGCGAATGAACAAGAGTACTTAAAAGAGCTTGCCAGTCATATAGCGATAG
AAAAGCCTCATCTTGTTGATTTATTATCCAATAAGATTCAGGATCCTGATGGTGCACGCTTGATGGATGG
GTTAGCCTATCTTTCAGGAAATCTTCGTGAACAGCTTGATAGGCAATTCTCTGAATTAACGAGCAGCCTA
GTCAATATGCTGTGGCCTGCTTATGCTCGTCCTTTTCCCAGCATGACTATTGTTGAGTATCAAACAGATG
CTCAGACACTCAGCTATGCAAGCAAAATAGCCGCGGGCCAACCTTTTGTAGCTAAACCCTTGTATGTTCA
AGGCGAAACCCCAAATGCAGATAGCCTGCACCAATGCCGATTTAGCCAATGCAGAGACCTTTGGTTATTA
CCTGCAAAAATTTCACATGTACGCCAACGAACCAAGTCCATTGAGATTGACTTCAAACTCGATAAACCCC
GCGTATTAGCAGAAATTGGCTTAGATAAGTTGCGTATCCATTTGAATGGTGCAACCTATACGACACATCA
ATTATTTTATTTGTTGAGCCATCGCATTAAGCAAGTGACGCTTGTCACCGAACATCATCGGTTGCCTTTA
GATAATTTTGCAGCATTGCCAGTGGGTTTCAAAAAAGAAGATGCTTTATTGCCGTACCCAAAAAATAGCT
ACGATGGGTATCGTATCTTGCAAGAGTACTTCTGTTTTCCTGAAGCCTTTATGTTTATGGATATTAAAGG
CCTTGAAGACCTACCTTTAGCACTGAATACAGATTCCTTCACATTAGAGATTGTGTTTGAAACGGAGATC
CCTGACGCGGTGGTGATCCGAGATGACAGCATCAAACTGAATTGTGTACCTATTGCCAATTTGTTCACTA
TTGACAGTGAAGCTATTGACCTTACAGGTAAAAATGATGACTACATCTTGAGCGCCAGTTATCGAACACC
ACTTTGTTATGACATTTTTTCGATTAACCAAGTACAAGGGTTAAGGTATCCACAAAATGCCTCTCCTTAT
GCCGTCAATTACACCGCATTTGAAAGCTTTCATCACCAAAGCCATAACCTGAAAGATAAAAATCATGGCT
ATTACAGGCTAAAAATCAATCAGATGAGAGAGGCGGTAGGCTATCGGCATACGCTCTCCTTTGTGCGTGA
CAATGAAACGAAACTACAAAACTGTGAAGAAACCGTTTCTGTATCATTAAATTGCACAAATAGGAATGTT
GCTTCAAGGCTTTCAACCCATTCGATTTCACTTGATAAAGCCTATCGGCCGGAAGGTGCTTTATCTGCCA
CAAACTTGTTTAAGCCAACAGCGCCATTATACCCATTGTTGGGTCAAACATTGTATTGGTCTGAATTAAC
GAATCTTTCGTTAAATTATCAATCACTTTTGAATCTAACCTCGTTGAAGCAGATTCTTCAACTCTATGAT
TTACCGTCTGTTTTTAATCGTCAAACAGCAAGGCAATCTCAGCAGTGCTTAGATTCTCTCATTAGCTTAA
ACACAGAGCATATTGAGCATCTTTATCGTGGGTTACCAGTAAGAGGATTAAAAACGACATTAACGGTTCG
TCAAAGTGCTTTTTTAAGTGAGGGTAGCTTGTACTTGTTTTGTACAGTTATTGCTCAATTTTTTGCTTTG
TATACCAGCGTGAATATGTTTCATGAGCTGGAAGTAATCAATATTGATAATAAGGAAACCTACCGGTGGC
CAGCACAAATCAATCAGCAAATACTGAAGTGA