SecReT6
Protein ID: 386743292
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09600
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2055608..2056045 [-]
Producthypothetical protein
NoteTssE
UniProt IDI0DTW2
KEGG IDpsi:S70_09600
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-18, Aligned region: 31..124
Protein Sequence: 145 a.a.     [Download]
>gi|386743292|ref|YP_006216471.1| hypothetical protein S70_09600 [Providencia stuartii MRSN 2154]
MAANYNWDSSETASLFERIQGKSSGSSHHARMDALVRSIKNNLNQILNSRPDACQSSASLGVPDLNDATQ
AATDFRRSLEHSITTCIQDFEPRISNVRVTFIENDADALLLQFSITAFIDLDSQRQLIEFNMQLDNNRRY
QLKQF
 
Nucleotide Sequence: 438 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2056045-2055608 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGGCTGCTAACTATAACTGGGATTCTTCAGAGACTGCCAGCTTATTTGAACGCATCCAAGGGAAGAGCT
CCGGCTCTTCCCATCATGCTCGAATGGATGCCTTAGTGAGATCAATTAAGAACAATTTAAATCAAATCCT
AAACAGTCGACCAGATGCTTGTCAAAGTTCGGCTAGCCTAGGAGTACCTGATTTAAATGATGCAACACAA
GCAGCAACAGATTTTAGGCGGAGCCTAGAACATTCTATTACAACCTGCATTCAAGACTTCGAACCTCGGA
TCAGTAATGTCCGAGTGACATTTATCGAAAATGATGCAGATGCCTTGTTGCTCCAGTTCAGCATCACCGC
TTTTATCGATCTCGACAGCCAGCGGCAGCTCATTGAATTTAATATGCAGCTCGATAACAACCGGCGATAT
CAGTTGAAACAATTCTAA