SecReT6
Protein ID: 386743293
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09605
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2056050..2057528 [-]
Producthypothetical protein
NoteTssC
UniProt IDI0DTW3
KEGG IDpsi:S70_09605
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.00E-185, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|386743293|ref|YP_006216472.1| hypothetical protein S70_09605 [Providencia stuartii MRSN 2154]
MSLNSETQEQQVSSSNVSLLDEIMAQSRMSPESEAYGIAKQGVAAFISNLFASQNEEEQINKLLIDKMLV
ELDNKLSTQVDQILHAPKFQELESSWRSLKLLVDRTDFRENIKINILHATKEELLEDFEFSPEIVQSGFY
QHVYSSGYGQFGGEPVAAVVGNYAFNNTTPDLKLMQYVSAVGAMAHAPFLSSVSPNFFGINSYAELPAIK
DIKSVFEGPAHTKWRSLREAEDSRYLGLTAPRFLLRLPYSPTENPVKLFNYTENVKQDHDHYLWGNTAFL
LASCINDSFAKYRWCPNIIGPQSGGTVSDLPVHVFEAMGELQAKIPTEVLVTDRREFELAEEGFITLTMR
KGSDNAAFFSANSVQKPKTFPNTHEGKIAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNIWLKQYIADQENPPADVRSKRPLRSAQIQVLDVEGDPGWYQVAIQVRPHFKYMGANFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2057528-2056050 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGTCATTAAATAGCGAAACGCAGGAACAACAAGTTTCCTCATCCAATGTTTCATTGTTAGATGAGATTA
TGGCTCAATCTCGTATGTCTCCTGAGTCAGAAGCTTATGGTATTGCCAAACAAGGTGTTGCTGCATTTAT
TAGCAATCTTTTTGCTAGCCAAAATGAAGAAGAGCAAATCAATAAGCTATTGATTGATAAAATGCTTGTT
GAGTTAGATAACAAGCTGAGTACACAAGTTGACCAAATTCTTCATGCACCAAAGTTCCAAGAGCTTGAGT
CTTCATGGCGTTCACTGAAACTGTTAGTTGACCGCACCGATTTTAGAGAAAACATCAAAATTAATATTCT
TCATGCAACGAAAGAAGAGTTATTGGAAGATTTTGAATTCTCTCCTGAAATCGTACAATCAGGCTTCTAT
CAGCACGTTTACTCATCCGGTTATGGCCAGTTTGGTGGTGAGCCAGTAGCCGCTGTAGTCGGTAACTATG
CTTTCAATAACACCACGCCTGATTTGAAATTAATGCAGTATGTGAGTGCTGTAGGCGCTATGGCGCATGC
ACCATTCCTTTCTTCCGTTTCACCTAATTTCTTTGGTATTAACAGCTATGCGGAATTACCTGCGATCAAA
GATATTAAGTCTGTCTTTGAAGGCCCTGCACATACTAAGTGGCGTTCATTGCGTGAAGCAGAAGATTCCC
GTTATCTTGGTTTAACAGCACCTCGCTTCTTGCTGCGTCTGCCATATTCACCAACAGAAAACCCGGTTAA
GTTGTTTAACTATACTGAAAATGTTAAGCAGGATCATGACCATTACCTTTGGGGAAATACGGCATTTTTA
TTAGCAAGCTGTATCAATGACAGTTTTGCTAAGTACCGTTGGTGCCCAAATATTATTGGCCCACAAAGTG
GTGGTACAGTTAGCGATCTTCCTGTACACGTGTTTGAAGCAATGGGCGAATTACAAGCTAAAATTCCAAC
TGAGGTTTTAGTTACTGATCGCCGTGAATTTGAATTGGCAGAAGAAGGCTTTATTACATTGACGATGCGT
AAAGGCAGCGACAATGCCGCGTTTTTCTCTGCGAACTCAGTTCAGAAACCTAAAACTTTCCCAAATACTC
ATGAAGGTAAAATTGCCGAAACCAATTATAAATTGGGAACTCAGCTTCCTTACATGTTCATTATCAACCG
CTTAGCACACTACATTAAAGTGCTACAGCGTGAACAAATCGGTTCATGGAAAGAACGTCAAGATTTGGAA
CGTGAACTGAACATTTGGTTGAAGCAATACATTGCTGATCAGGAAAACCCACCGGCTGATGTACGTAGCA
AACGTCCATTACGTTCAGCACAGATCCAAGTTCTCGATGTCGAAGGGGATCCAGGTTGGTATCAAGTTGC
GATTCAAGTCCGCCCTCATTTCAAATACATGGGTGCTAACTTTGAATTGTCACTTGTTGGTCGCCTAGAC
AAAGAGTAA