SecReT6
Protein ID: 386743294
SecReT6 ID640
T6SS typei1
Gene symbol-
Locus tagS70_09610
StrainProvidencia stuartii MRSN 2154
Repliconchromosome [GenBank: NC_017731] [Browse all T6SS(s) in this replicon]
Location [Strand]2057549..2058046 [-]
Producthypothetical protein
NoteTssB
UniProt IDI0DTW4
KEGG IDpsi:S70_09610
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-58, Aligned region: 8..160
Protein Sequence: 165 a.a.     [Download]
>gi|386743294|ref|YP_006216473.1| hypothetical protein S70_09610 [Providencia stuartii MRSN 2154]
MSKKDLGSVAPKERINIKYTPNDGGAKSEIELPLNMLIVGDMIGRTEETPIEERKAISINQNNFNSVMES
AGISLNINVENTLDEKSDSDLNVNLDIKSLQDFSPDNVARQVPELKKLLELREALVALKGPLGNIPAFRK
RLQELLDNEETREQLLKELDIASQK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|386741417|ref|NC_017731.1|:c2058046-2057549 Providencia stuartii MRSN 2154 chromosome, complete genome
ATGAGTAAAAAAGATCTCGGTAGTGTTGCACCAAAAGAAAGGATTAATATCAAATATACACCTAATGATG
GTGGAGCTAAATCTGAAATAGAATTGCCGCTTAATATGCTAATCGTGGGAGACATGATTGGTCGAACGGA
GGAAACTCCGATTGAAGAGCGTAAAGCTATTTCCATTAACCAGAATAACTTTAATTCAGTCATGGAAAGT
GCTGGAATAAGCTTAAATATCAATGTGGAAAATACACTTGATGAGAAAAGTGATTCTGATCTTAATGTGA
ATTTAGATATTAAATCCCTTCAAGATTTTTCTCCCGACAATGTTGCTCGCCAAGTTCCAGAATTGAAAAA
ATTACTTGAACTTAGAGAGGCATTAGTCGCTTTGAAAGGTCCTCTTGGCAATATTCCTGCTTTTAGAAAA
CGTCTGCAAGAGCTTCTAGATAATGAAGAGACTCGCGAACAGTTGCTGAAAGAACTTGATATTGCTAGCC
AAAAATAA