SecReT6
Protein ID: 386762101
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1423
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1417667..1419391 [-]
Producttype VI secretion protein VC_A0110 family
NoteTssF
UniProt IDI2FCN8
KEGG IDhcp:HCN_1423
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-130, Aligned region: 8..572
Protein Sequence: 574 a.a.     [Download]
>gi|386762101|ref|YP_006235737.1| type VI secretion protein VC_A0110 family [Helicobacter cinaedi PAGU611]
MNNEDVFYYQKELSYLYQTREYFVKKFPKLAPFLALDSKDPDIERIIENLAILTSKIHQEMEQNIPYIAE
SLLNVVSPNYTNPLPSLCMQEFLLNKDSKKNKIIVPKGSRLQSITIEQIECEFRTIYDVYLYPLDIDEVF
MSSEKQYHTMDLRLKVNKPDLKICDIGLDCLNLYLGDDIYTSATLLLFIHLYLEEVKIISCDTSEKFKLN
SCNIKTIGLEPNESCLNYDDLGFEAFSLLREYFFIPEKFNFIRIQGLDILKDCQGSNLSIQFKFNKIFPK
NCIVRADLFSLSITPIVNIFPKNAESIINDHTKDGYRIFVDRVHLDSYEIIKINQVKAHNSDSGRRILKN
YKSFERFEFLKDNQNEFYSINVKKNSKGETYKEISFFSEHSYNEIITIDALCCNKNLPSKLKIGDIRHIN
FEDISTKNIKIPSMMREYSVDGHLLWKLVSILSFNYQSILNTTSFFGVLESYSFVNDKENEETYKRLKNS
IAYIESKSTYLVDEYITKKGTLCIMGIKDSNFYSLGEVYKLGLIISKFFASFVSINSFCELKIKCLDSKE
ILYYPATRGKKVSL
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|386760820|ref|NC_017761.1|:c1419391-1417667 Helicobacter cinaedi PAGU611, complete genome
GTGAATAATGAAGATGTATTTTACTACCAAAAAGAGCTTTCCTATCTCTATCAAACAAGAGAATATTTTG
TCAAAAAATTTCCAAAACTCGCACCATTTTTAGCTCTTGATAGTAAAGACCCAGATATTGAGAGAATTAT
TGAAAATCTTGCTATTTTGACTTCTAAAATTCATCAGGAAATGGAACAAAATATTCCATACATAGCAGAA
TCTTTGTTGAATGTAGTCTCTCCTAATTATACTAATCCACTACCTTCTTTGTGTATGCAAGAGTTTCTTT
TAAATAAAGATAGTAAAAAAAATAAGATTATTGTTCCAAAAGGAAGTCGCCTTCAGTCTATAACCATAGA
ACAAATTGAGTGTGAGTTTAGAACGATTTATGATGTTTATCTCTACCCTTTAGATATTGATGAAGTGTTT
ATGAGCAGTGAAAAACAATATCACACAATGGATTTAAGGTTAAAGGTTAATAAGCCTGATTTAAAAATTT
GTGATATAGGATTAGATTGTTTAAATTTATATCTTGGAGATGACATCTACACTTCCGCAACTTTACTTTT
ATTCATTCACCTTTATTTGGAGGAGGTAAAAATCATTTCTTGTGATACTTCTGAAAAGTTTAAGCTTAAT
TCTTGCAACATTAAAACAATAGGGCTTGAACCAAATGAAAGTTGTTTAAATTATGATGATTTAGGGTTTG
AGGCTTTTTCTTTGCTTAGGGAGTATTTTTTTATCCCTGAAAAATTTAATTTTATAAGAATACAGGGTTT
AGATATTTTAAAGGATTGTCAAGGCTCAAATTTGAGTATTCAATTTAAGTTCAATAAAATTTTTCCAAAG
AATTGCATCGTCAGAGCAGATTTATTTTCTTTAAGCATTACGCCTATTGTGAATATTTTTCCCAAAAATG
CAGAATCAATTATTAATGACCATACCAAAGATGGATATAGGATTTTTGTAGATAGGGTGCATTTAGATTC
TTATGAAATTATAAAGATTAATCAAGTCAAAGCTCACAATAGTGATAGTGGAAGAAGGATTCTTAAAAAT
TATAAGAGTTTTGAACGTTTTGAGTTTTTAAAAGACAATCAAAATGAATTTTATAGTATAAATGTTAAAA
AAAATTCTAAAGGTGAAACATACAAAGAAATTTCTTTTTTTTCAGAGCATTCTTACAATGAGATAATTAC
CATTGATGCTTTGTGTTGTAATAAGAATTTACCCTCTAAGCTTAAGATAGGCGATATAAGACATATTAAT
TTTGAGGATATATCCACTAAAAATATTAAAATCCCAAGTATGATGAGAGAATATAGCGTTGATGGGCATT
TACTTTGGAAGCTTGTATCTATACTCTCTTTTAATTATCAAAGTATTCTTAATACAACTTCATTTTTTGG
AGTATTAGAAAGTTATAGTTTTGTCAATGACAAGGAGAATGAAGAAACTTATAAGCGTTTAAAAAATTCT
ATTGCATATATAGAATCTAAATCGACTTACCTCGTTGATGAATACATTACAAAAAAGGGAACACTCTGTA
TAATGGGCATTAAGGATTCTAATTTTTATTCTTTGGGAGAAGTTTATAAATTAGGGCTTATAATATCTAA
ATTTTTTGCTTCTTTTGTAAGCATTAATTCTTTTTGCGAATTAAAGATAAAATGCTTGGATAGCAAAGAG
ATTTTGTATTATCCAGCTACTCGCGGCAAAAAAGTTTCTTTATGA