SecReT6
Protein ID: 386762102
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1425
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1419786..1421240 [-]
Producttype VI secretion protein EvpB/VC_A0108 family
NoteTssC
UniProt IDI2FCN9
KEGG IDhcp:HCN_1425
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-179, Aligned region: 57..482
Protein Sequence: 484 a.a.     [Download]
>gi|386762102|ref|YP_006235738.1| type VI secretion protein EvpB/VC_A0108 family [Helicobacter cinaedi PAGU611]
MSSDKVVDTPIIESIMEKSKYLKNDESYSIAKRGVAEFISAIVENDDVEDKINKFALDEMIAHIDDLVSK
QMDEILHNEDFQKLESVWRGLYFLVERTDFNENIKINLFDVTKEEALEDFENNPDITQSVIYKNIYSSEY
GQFGGEPVGAIIGDYQLSTNSPDMTFLNKMASIAAMSHSPFLTSCAPSFFGLENYSELANIQDLGGLLQG
PQYTRWRTFRENEDSKYVGLMVTRFLTRSPYSPEENPIKTFNYKENVHNSHNHLLWGNSAYAFATRLTES
FAKYRWCGSIIGPKSGGSVKDLPTYLYESFGTMQSKIPTEVLITDRREYELAEAGFIALTLRRDSNNAAF
FSANSALKPKVFPNTPEGKEAETNYRLGTQLPYIFLISRLAHYLKVLQREEIGSWKERTDIENGLNEWVR
QYISDQENPPAEVRSRRPFRGAQIKVDNVAGEPGWYKIGLSVRPHFKYMGGNFELSLVGKLDKE
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|386760820|ref|NC_017761.1|:c1421240-1419786 Helicobacter cinaedi PAGU611, complete genome
ATGTCAAGCGATAAAGTGGTTGATACACCTATTATTGAAAGCATTATGGAAAAAAGTAAGTATTTAAAAA
ATGATGAAAGTTATAGTATAGCTAAAAGAGGTGTTGCCGAATTTATCTCTGCTATTGTTGAGAATGATGA
TGTAGAAGATAAAATTAATAAATTTGCTTTAGATGAGATGATAGCACATATTGATGATTTAGTATCTAAG
CAAATGGACGAGATTCTACACAATGAGGATTTCCAAAAACTAGAGTCTGTATGGAGAGGCTTATATTTCT
TAGTAGAAAGAACAGATTTTAATGAAAATATTAAAATCAACCTTTTTGATGTAACCAAAGAAGAAGCTTT
AGAAGATTTTGAGAACAATCCTGATATTACCCAAAGTGTCATTTATAAAAATATTTATTCTTCAGAATAT
GGACAATTTGGTGGAGAGCCTGTTGGTGCTATCATAGGCGATTATCAGCTTAGCACCAATAGTCCAGATA
TGACTTTTTTAAATAAAATGGCAAGTATTGCTGCAATGAGCCATTCGCCATTTTTAACCTCTTGTGCTCC
TAGTTTTTTTGGGTTAGAGAATTATTCAGAGTTAGCAAATATTCAAGATTTAGGAGGTTTGCTTCAAGGT
CCTCAATACACTAGATGGAGAACCTTTAGAGAAAATGAAGATTCAAAATATGTGGGGCTTATGGTAACAA
GATTTTTAACACGCTCTCCTTATAGTCCAGAAGAAAATCCTATCAAAACTTTTAATTATAAAGAAAATGT
TCATAATTCACATAATCATTTATTATGGGGCAATTCAGCTTATGCCTTTGCTACAAGATTAACTGAAAGT
TTTGCAAAATATAGATGGTGTGGAAGTATTATAGGTCCAAAAAGTGGAGGGAGCGTGAAAGATTTACCTA
CTTATCTTTACGAGAGTTTTGGCACTATGCAATCCAAGATTCCAACCGAAGTGCTTATTACAGATAGAAG
AGAATATGAGCTTGCTGAAGCAGGGTTTATTGCTTTGACTTTAAGAAGAGATAGTAATAATGCAGCTTTT
TTCTCTGCAAATTCAGCTTTAAAACCTAAAGTATTTCCAAATACACCTGAGGGAAAGGAAGCAGAAACGA
ATTATCGATTGGGAACACAGCTTCCTTATATATTCCTTATATCAAGATTAGCACATTATCTTAAGGTTTT
ACAAAGAGAAGAAATAGGTAGTTGGAAAGAAAGAACTGATATTGAAAACGGACTCAACGAATGGGTAAGA
CAATATATTTCAGACCAAGAAAATCCTCCTGCTGAAGTCCGAAGTAGGAGACCATTTAGAGGAGCTCAGA
TCAAAGTGGATAATGTGGCTGGAGAGCCGGGATGGTATAAGATAGGGCTTAGTGTTCGCCCTCATTTTAA
ATATATGGGCGGAAATTTCGAACTTTCATTAGTGGGCAAACTTGATAAAGAGTGA