SecReT6
Protein ID: 386762103
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1426
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1421249..1421734 [-]
Producttype VI secretion protein VC_A0107 family
NoteTssB
UniProt IDI2FCP0
KEGG IDhcp:HCN_1426
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-54, Aligned region: 5..157
Protein Sequence: 161 a.a.     [Download]
>gi|386762103|ref|YP_006235739.1| type VI secretion protein VC_A0107 family [Helicobacter cinaedi PAGU611]
MSDGSSAPKERINITYKAKTNGQEADVELPLKLMVMTNLTGGADKLPLEEREILQINKVNFSQVMQKLDI
SSKFSVKNTLGTGAEELSINLKISSMKDFSPDSIAKQIPELNKLMQLREALVALKGPMGNIPDFRKAVLT
ALKDKKTKEKLLLEIKEEVKE
 
Nucleotide Sequence: 486 bp     [Download]
>gi|386760820|ref|NC_017761.1|:c1421734-1421249 Helicobacter cinaedi PAGU611, complete genome
ATGTCTGATGGTTCTAGTGCTCCAAAAGAGCGTATTAATATCACATACAAAGCAAAAACGAATGGACAAG
AAGCAGATGTTGAGTTACCCTTAAAATTGATGGTAATGACAAATTTGACAGGAGGAGCTGATAAATTACC
TTTGGAAGAGCGAGAGATTTTACAAATTAATAAGGTAAATTTTAGTCAGGTAATGCAGAAATTGGATATT
AGTTCTAAATTTAGTGTTAAGAACACCTTGGGCACAGGAGCAGAAGAGCTAAGTATTAATCTTAAAATTT
CTAGTATGAAAGACTTTTCCCCAGATAGTATAGCAAAGCAAATTCCCGAGCTTAATAAACTTATGCAACT
AAGAGAGGCTTTAGTGGCTTTAAAAGGACCTATGGGTAATATTCCAGATTTTAGAAAAGCAGTTTTAACC
GCTTTAAAAGATAAAAAAACAAAAGAGAAATTGCTTTTAGAAATTAAAGAAGAAGTCAAAGAATAG