SecReT6
Protein ID: 386762104
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1428
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1423204..1423659 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDI2FCP1
KEGG IDhcp:HCN_1428
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.30E-17, Aligned region: 19..147
Protein Sequence: 151 a.a.     [Download]
>gi|386762104|ref|YP_006235740.1| type VI secretion lipoprotein [Helicobacter cinaedi PAGU611]
MYQKILILALCLLFGACSNNVSVKISNIEKSNLNNRFDDVPVTLIIYKLKDVKKFEEANDKDLITREDGA
LGKDKIDSIKLQIAPKSEIVAIKVKDKEVPYIGLLALFASDTKKVTKAWVKTKDVSGLWSRFWNEKTLKF
EITQEGIKTIK
 
Nucleotide Sequence: 456 bp     [Download]
>gi|386760820|ref|NC_017761.1|:1423204-1423659 Helicobacter cinaedi PAGU611, complete genome
ATGTATCAAAAAATACTAATTTTGGCTTTATGTCTTTTATTTGGAGCTTGCTCAAACAATGTGAGTGTAA
AAATAAGTAACATTGAAAAATCAAATCTTAATAATAGATTCGATGATGTTCCTGTTACTCTTATTATCTA
TAAACTTAAGGATGTTAAAAAATTTGAAGAAGCAAATGATAAGGACTTAATTACTAGAGAAGATGGAGCT
CTTGGTAAGGATAAAATAGATTCAATCAAATTACAAATTGCTCCTAAAAGCGAAATTGTAGCAATAAAAG
TTAAGGATAAAGAAGTTCCCTACATTGGTCTTTTAGCTTTATTTGCCAGTGATACAAAAAAAGTAACTAA
AGCTTGGGTTAAAACAAAAGATGTAAGCGGACTTTGGAGTAGATTTTGGAATGAAAAAACACTAAAATTT
GAAATCACACAAGAAGGAATTAAAACGATTAAATGA