SecReT6
Protein ID: 386762105
SecReT6 ID641
T6SS typei1
Gene symbol-
Locus tagHCN_1429
StrainHelicobacter cinaedi PAGU611
Repliconchromosome [GenBank: NC_017761] [Browse all T6SS(s) in this replicon]
Location [Strand]1423676..1425076 [+]
Producttype VI secretion protein VC_A0114 family
NoteTssK
UniProt IDI2FCP2
KEGG IDhcp:HCN_1429
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-114, Aligned region: 19..465
Protein Sequence: 466 a.a.     [Download]
>gi|386762105|ref|YP_006235741.1| type VI secretion protein VC_A0114 family [Helicobacter cinaedi PAGU611]
MANQLKVAWFNGLNIDKIHFEQQERYFQRNIDLKTIEVSNNLYGIIDLKFSNELLIQGKIALEKISGIAK
DGSIFNAPEQDLLPEALEINYESLENSVIVLKIPLSTASIADVALQNNFPNSKYLTLRSIIASRTYDDNH
SVGISRELLEDEKDLQNTTFTQEKINLTLASLRLKLGILGNATPDELEIPIAKIKNIDSNKKIELEENFI
PTCININKVSIVKSFLEETLYSIKQHKEILWEVFKGIDQTKNTLDFSTYLSLNLLKKWFLIFSYLIHKNK
LHPEYLYEKLIEFQGELGAFGVENSFLEFIAYQHDNLNETFFPLINNIKILFAKITSPRYSMAKLIDNGN
GFYDLLFDNAGILEESELFLAINADVNHEYLLKNFKTQSKIHTQSKIKNIVATQLRGLNIIQIPNIPSAI
PYLNGYVYYKLDKKDELFKHFKGENAISIYLTHNIKNPDIKMWAVF
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|386760820|ref|NC_017761.1|:1423676-1425076 Helicobacter cinaedi PAGU611, complete genome
ATGGCAAATCAACTAAAAGTTGCTTGGTTTAATGGTTTAAATATTGATAAAATTCATTTTGAACAGCAAG
AGAGATATTTTCAAAGAAATATAGATTTAAAAACCATTGAAGTATCAAATAATCTTTATGGAATTATTGA
TTTAAAATTTTCTAATGAACTGCTTATACAAGGTAAGATTGCATTAGAAAAAATTTCTGGGATAGCTAAA
GATGGAAGTATTTTTAACGCTCCAGAACAAGATTTATTGCCAGAAGCTTTAGAAATCAATTATGAATCAT
TAGAAAATTCGGTTATAGTATTAAAAATCCCTCTAAGCACTGCTAGCATTGCTGATGTAGCCCTACAAAA
TAATTTTCCTAATTCTAAATACCTAACTTTAAGAAGCATTATTGCCTCAAGAACTTATGATGATAACCAT
AGTGTAGGTATTTCAAGGGAATTATTAGAAGATGAAAAAGATTTACAAAATACAACTTTTACTCAGGAAA
AAATTAACTTAACGCTTGCGAGTTTGAGACTGAAACTCGGAATTTTAGGCAATGCAACACCTGATGAACT
TGAGATTCCTATTGCCAAAATTAAAAATATAGATTCAAATAAAAAAATAGAGCTTGAAGAAAATTTTATT
CCTACCTGTATTAATATCAACAAAGTTTCCATTGTCAAGTCTTTTTTAGAAGAAACATTATATTCTATCA
AACAACATAAAGAGATACTTTGGGAAGTTTTTAAAGGCATTGACCAAACAAAAAATACTTTAGATTTTAG
CACTTATTTATCTTTAAATCTTCTTAAAAAATGGTTTTTAATTTTTTCTTACCTTATTCACAAGAACAAA
TTACACCCCGAATATTTATATGAAAAGCTTATTGAATTTCAGGGGGAACTTGGGGCATTTGGCGTTGAAA
ATTCCTTTTTAGAATTTATTGCCTACCAACACGATAATTTAAATGAAACTTTTTTTCCTTTAATCAATAA
TATAAAGATTTTATTTGCTAAAATTACTTCTCCGAGATATTCAATGGCAAAACTTATAGATAATGGTAAT
GGTTTCTATGATTTGTTATTTGATAACGCTGGAATTTTAGAAGAATCTGAACTTTTCTTAGCCATTAATG
CTGATGTTAATCACGAATATTTATTAAAAAACTTTAAAACACAAAGTAAAATCCATACGCAGAGTAAAAT
CAAAAATATAGTAGCTACTCAACTTAGAGGATTGAATATTATCCAAATTCCAAATATTCCTTCAGCTATC
CCTTATTTAAATGGCTATGTTTATTATAAGCTAGATAAAAAAGATGAATTGTTTAAACATTTTAAAGGAG
AAAACGCAATAAGTATTTACCTTACTCATAATATTAAGAATCCTGATATAAAAATGTGGGCAGTATTTTA
A