SecReT6
Protein ID: 386860302
SecReT6 ID642
T6SS typei4b
Gene symboltssL-1
Locus tagBP1026B_I0182
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]174161..174946 [-]
Producttype VI secretion system
NoteTssL
UniProt IDI1WF09
KEGG IDbpz:BP1026B_I0182
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|386860302|ref|YP_006273251.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSYAPSLFGGNTPPPAPQTASSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFGTRIQEFLSEFE
RGAKKLNIAADDVYAAKFAFCAAIDESVLSSPFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGA
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQISHRLKREVPL
WAIGAVFALVGLLAFVGLNTYLKDSTVRALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|386860126|ref|NC_017831.1|:c174946-174161 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGAGTTACGCGCCCTCCCTCTTCGGCGGCAACACGCCGCCCCCCGCGCCGCAAACGGCTTCGTCGACCG
ACGCCGGCTTCCAGGCGCGCTCGCTCGTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGCTGAA
GAACGGCCGCGAGCCGAACGACGCGTCGGAATTCGGCACGCGCATTCAGGAATTCCTGAGCGAGTTCGAA
CGCGGCGCGAAGAAGCTCAACATCGCCGCCGACGACGTCTATGCGGCGAAGTTCGCGTTTTGCGCGGCGA
TCGACGAATCGGTACTGTCGTCGCCGTTCAAGATCCGCGCGGACTGGGAGCGCCGGCCGTTGCAGCTCGT
GCTGTTCGGCGAGCAACTCGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAATGCCGCGCGCAGGGCGCG
GCGCGGCTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCG
AAGGGCCGGAAAAGCTCGCGTATCTGACCGCACGGCTTGGCGACGAGATCGCGAACATGAAGGGCAAGCG
CGCACCGTTCGCGCCGCATTGGCCGCTGCCGGACCAGATCTCGCACCGGCTCAAGCGCGAGGTGCCGCTG
TGGGCGATCGGGGCGGTGTTCGCGCTCGTCGGGCTGCTGGCGTTCGTCGGGCTGAATACGTATTTGAAAG
ACAGTACCGTGCGGGCGCTCGCGCCTTATTCGCAAGTCATCAAGGTGGGGCCGGAGTCGGCTAATTTGAC
GATTTCGTTGCCTTGA