SecReT6
Protein ID: 386860304
SecReT6 ID642
T6SS typei4b
Gene symboltssJ-1
Locus tagBP1026B_I0184
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]176398..177051 [-]
Producttype VI secretion system
NoteTssJ
UniProt IDI1WF11
KEGG IDbpz:BP1026B_I0184
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-37, Aligned region: 28..189
Protein Sequence: 217 a.a.     [Download]
>gi|386860304|ref|YP_006273253.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MTGSKGRTRPEKSMNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLG
LTLYAAQNLNAANDNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITLIPGQHYN
ATEKVSREAQAFGVVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDL
LSSVNCG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|386860126|ref|NC_017831.1|:c177051-176398 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
TTGACAGGGAGCAAGGGGCGGACGCGCCCTGAAAAATCGATGAATCCGCATGTGACTCGTTACGCGCTGC
CGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCGCCGTGCCGCTCCTCGGTTCGGCGGGCAGCGC
CGCGCTGCAGATGGTGGGCGTCGGCAAACCCGACGTGCCCGATTCGCAGAAGCCGCCGCGCAATCTCGGC
CTCACGCTCTATGCGGCACAGAACCTCAACGCCGCGAACGACAACCGTCCGCTCGCGCTCGTCGTGCGCC
TCTACGCGCTGAAAGATCCGACGTCGTTCCAGCAGGCGCCGTTCGACAGCTTCACCGATCCGACGAAAGA
AAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTACGCGAAATCACGCTGATTCCGGGGCAGCACTACAAC
GCGACCGAAAAGGTGTCGCGCGAGGCGCAGGCATTCGGCGTCGTCGCGCTCTTTCGCGATCCGGCGCTAC
AACGCTGGAAACTGACTTTCGATCCGGCGAAATCCGAGAAATCCGGCATAATCATTGGCCTGCACAACTG
CGCGATGACCGTGACGGGCGGCACCGTCATCCCTTCGCAGCAAGGCATGCCGACGCAGCGGCTCGATTTG
CTGTCGTCGGTGAACTGCGGGTGA