SecReT6
Protein ID: 386860307
SecReT6 ID642
T6SS typei4b
Gene symboltssB-1
Locus tagBP1026B_I0187
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]178095..178613 [+]
Producttype VI secretion system
NoteTssB
UniProt IDI1WF14
KEGG IDbpz:BP1026B_I0187
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.10E-59, Aligned region: 11..164
Protein Sequence: 172 a.a.     [Download]
>gi|386860307|ref|YP_006273256.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|386860126|ref|NC_017831.1|:178095-178613 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGGCGAAGAAAGAAAGCATTCAAAAGCGCTTGCAGAAAGTGCGGCCGCCCCGCGTCCAGTTGACGTACG
AGGTCGAACGGGGCGATGCGATCGAGATCAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGGCAGTCCGAAATCGAGCAGCCGAAGCTGCGCGATCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GATGACGTGATGAAGGCGATCGAGCCGCGCGCGACGTTCCAGGTGGAGAACCGCCTGAGCGAGGCGGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGATCAACGATTTCAATCCGGACGAAGTCGTCGGGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCGGACCTGCGCAACAAACTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGAGCGAAGTGCTGTCGAACACGCAGCAACTCGAAGCGCTGAAGAAGAGCG
CGGACGGCGGCGACAAGCAGGGCGAATGA