SecReT6
Protein ID: 386860309
SecReT6 ID642
T6SS typei4b
Gene symbolhcp-1
Locus tagBP1026B_I0189
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]180175..180696 [+]
Producttype VI secretion system
NoteTssD
UniProt IDI1WF16
KEGG IDbpz:BP1026B_I0189
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.20E-45, Aligned region: 12..145
Protein Sequence: 173 a.a.     [Download]
>gi|386860309|ref|YP_006273258.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MGSRKTMLHMHLKFGSPAIKGESADKDHEGWIELKSWDHSIVQPRSATASTAGGHTATRCEHGDMVFTKE
IDSSSPLLYQHASGGTTFDEVTIDFLRADGEGQRVKYLEIKLKYVIISSIAPSVHTEGLPVETFSLKYAA
VQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 522 bp     [Download]
>gi|386860126|ref|NC_017831.1|:180175-180696 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
TTGGGGAGTCGAAAGACCATGTTACACATGCATTTGAAGTTCGGTAGTCCCGCCATCAAGGGCGAGTCCG
CCGACAAGGACCACGAAGGCTGGATCGAGCTGAAATCCTGGGATCACTCGATCGTTCAGCCGCGTTCGGC
GACCGCATCGACGGCGGGCGGCCACACGGCGACGCGTTGCGAGCACGGCGACATGGTGTTCACGAAGGAA
ATCGATTCGTCGAGCCCGCTGCTGTATCAGCACGCGTCGGGCGGCACCACGTTCGACGAAGTGACGATCG
ATTTCCTGCGCGCGGACGGCGAAGGCCAGCGCGTGAAGTATCTCGAGATCAAGCTGAAGTACGTGATCAT
CTCGAGCATCGCGCCGAGCGTGCATACCGAAGGCCTGCCGGTCGAGACCTTCTCGCTGAAGTACGCCGCG
GTCCAGTGGAAGCAGACGCAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCC
TCACGAAGAACGACAAGACCTACGCGGTCTAA