SecReT6
Protein ID: 386860310
SecReT6 ID642
T6SS typei4b
Gene symboltssE-1
Locus tagBP1026B_I0190
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]180754..181236 [+]
Producttype VI secretion system
NoteTssE
UniProt IDI1WF17
KEGG IDbpz:BP1026B_I0190
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.00E-22, Aligned region: 29..137
Protein Sequence: 160 a.a.     [Download]
>gi|386860310|ref|YP_006273259.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELPECQRSVLTYG
LNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNALYFAIQALLVVHPAEEPVTFD
AMLQPSTLQYSVTRSRAAKV
 
Nucleotide Sequence: 483 bp     [Download]
>gi|386860126|ref|NC_017831.1|:180754-181236 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGAAACGTTTCGAACCGAGCTTCCTCGACAAGCTGTTCGACGACGAACCGCACGTGCCGGCGCCCGCCG
CGATGCGGCAGTTGTCGCTGGAGGAGCTGAAGAACACGGTCGCGCGCGACGTCGAGGCGATCCTCAACAC
GCGCATCGCGCTGACCGAAGAAGATCTCGCCGAGCTGCCCGAATGCCAGCGCTCGGTGCTGACCTACGGG
CTGAACGATTTCGCCGGCCTGAGCCTCGCGAGCCACTACGATCGCACGTTCATCTGCAAATCGATTCAGC
AGGCGATCGCGCGGCACGAGCCGAGGCTGCAGCAGGTGCAGGTGGCGTTCGAGCTGAACGAGCAGTCGAC
GAACGCGCTCTATTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCCGCCGAGGAACCGGTGACCTTCGAT
GCGATGCTGCAGCCGTCGACGTTGCAATATTCGGTGACGCGTTCGCGCGCCGCCAAGGTGTGA