SecReT6
Protein ID: 386860311
SecReT6 ID642
T6SS typei4b
Gene symboltssF-1
Locus tagBP1026B_I0191
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]181316..183154 [+]
Producttype VI secretion system
NoteTssF
UniProt IDI1WF18
KEGG IDbpz:BP1026B_I0191
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-212, Aligned region: 4..611
Protein Sequence: 612 a.a.     [Download]
>gi|386860311|ref|YP_006273260.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MEELLPYYERELSFLRRYSLEFANRYPKIAARLAQTGEQCEDPHVERMIESFALLGARINKKLDDEYPEF
TEALVEVLYPHYLRPFPSCSIAQFGAPHAFAELTEPRIVERGTELKSRAIRGVQCRFRTAYDVTLAPIRL
ADARYGSVAVAPAAARLPGNATGVISIAFESTSPQLDLAALKLGKLRAHLHGEQSFVAALADCLFAHALA
CYVEPDRGGRWIALGKTPFEHAGFDETDALIDYPARSHPAYRLLTEYFAFPDKFNFVDFDLGALARRAGP
CRQLTLHIALRDVRGDSHVARLLDLLSASHFRLFCTPVVNLFRQHGEPIRVDHRAVSYPVIGDARRAFAY
EVYSIDSVHLVRQRADRETLVEFRPFYSLHHGEAAQAGHYWFARRNDDVARKSPGYETEISVVDVDFEPG
APQTDTLSLDLTCTNRDLPAALATGLDGGDLFIDGGEQPGPIALLRRPTPSARFERGHAAHWRLVSHLAL
NHVSLAEEGLAALKEALVLYDLRRSAVSTRHIDGIVGIEQKSAVQWLPGKPFATFVRGVEIRLAIDDEHF
VGSSLATFVRMIDAFFGLYVHLNSFVQLIVVSRRTGEEIMRCKPRSGESILA
 
Nucleotide Sequence: 1839 bp     [Download]
>gi|386860126|ref|NC_017831.1|:181316-183154 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGGAAGAGTTGTTGCCGTATTACGAACGCGAACTGTCGTTTCTGCGGCGCTATTCGCTCGAATTCGCGA
ACCGTTACCCGAAGATCGCCGCGCGTCTCGCCCAGACGGGCGAGCAGTGCGAGGATCCGCACGTCGAGCG
GATGATCGAATCGTTCGCGCTGCTCGGCGCGCGGATCAACAAGAAGCTCGACGACGAATATCCCGAGTTC
ACCGAAGCGCTCGTCGAAGTCCTCTACCCGCACTATCTGCGGCCGTTCCCGTCATGCTCGATCGCGCAGT
TCGGTGCGCCGCATGCGTTCGCGGAGCTCACCGAGCCGCGGATCGTCGAGCGCGGCACCGAGCTGAAGAG
CCGCGCGATTCGCGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGGCTC
GCCGATGCGCGCTACGGATCGGTCGCGGTGGCGCCCGCCGCAGCAAGGCTGCCCGGCAACGCGACGGGCG
TGATCTCGATCGCGTTCGAATCGACGTCGCCGCAGCTCGATCTTGCCGCGCTGAAGCTCGGCAAGCTGCG
CGCGCATTTGCACGGCGAGCAATCGTTCGTCGCCGCGCTGGCCGATTGCCTGTTCGCGCACGCGCTCGCC
TGCTACGTCGAGCCCGATCGCGGCGGCCGCTGGATCGCGCTCGGCAAGACGCCGTTCGAGCACGCGGGCT
TCGACGAGACCGACGCGCTGATCGACTATCCGGCCCGTTCGCACCCGGCCTATCGGCTGCTGACCGAATA
CTTCGCATTCCCGGATAAATTCAACTTCGTCGATTTCGATCTGGGCGCACTCGCGCGGCGCGCGGGGCCC
TGCCGGCAGCTGACGCTGCACATCGCGCTGCGCGACGTGCGCGGCGATTCGCATGTCGCGCGGCTGCTCG
ATCTGCTGAGCGCGAGCCATTTCCGGCTCTTCTGCACGCCGGTCGTGAACCTGTTCCGCCAGCACGGCGA
GCCGATTCGGGTCGACCACCGGGCGGTGTCGTACCCGGTGATCGGCGATGCGCGCCGCGCGTTCGCGTAC
GAGGTATATTCGATCGATTCGGTGCATCTCGTGCGGCAGCGCGCGGACCGCGAAACGCTCGTCGAATTCC
GGCCGTTCTATTCGCTGCATCACGGCGAAGCCGCGCAGGCCGGCCACTACTGGTTCGCGCGGCGCAACGA
CGACGTCGCGCGCAAGAGCCCCGGCTACGAGACCGAGATTTCGGTCGTCGACGTCGACTTCGAGCCGGGC
GCGCCGCAAACCGATACGTTGAGCCTCGATCTCACCTGTACGAACCGCGACCTGCCCGCCGCGCTCGCAA
CGGGGCTCGACGGCGGCGATCTCTTCATCGACGGCGGCGAGCAGCCCGGCCCGATCGCGCTATTGCGCCG
GCCGACGCCGAGCGCGCGCTTCGAGCGCGGCCACGCCGCGCACTGGCGCCTCGTGTCGCATCTCGCGCTC
AATCACGTGTCGCTTGCCGAAGAAGGGCTCGCCGCGCTGAAGGAAGCGCTCGTGCTGTACGATCTGAGGC
GCTCCGCGGTGTCGACGCGCCATATCGACGGGATCGTCGGCATCGAGCAGAAGAGCGCGGTGCAATGGCT
GCCGGGCAAGCCGTTCGCGACGTTCGTGCGCGGCGTCGAGATCCGGCTCGCGATCGACGACGAACATTTC
GTCGGCTCGAGCCTCGCGACGTTCGTGCGGATGATCGACGCGTTCTTCGGGCTGTACGTGCACCTCAACA
GCTTTGTTCAACTGATCGTCGTGTCCAGGCGCACCGGCGAGGAGATCATGCGATGCAAACCGCGCAGCGG
CGAATCGATCCTGGCGTAG