SecReT6
Protein ID: 386860312
SecReT6 ID642
T6SS typei4b
Gene symboltssG-1
Locus tagBP1026B_I0192
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]183118..184218 [+]
Producttype VI secretion system
NoteTssG
UniProt IDI1WF19
KEGG IDbpz:BP1026B_I0192
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.10E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|386860312|ref|YP_006273261.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKHDAPRHAASRPGEIVARRIGFRNTLSLGFPPS
EIERAQSYDAAGAALKDDVRRNAALEAGALSRVELTPAFFGLLGGQGALPLHYTEQIIAREQLKRDHAAH
AFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLLALAGVSNDDARSTVQQGRGALLDEAIAGYA
LAARHRPVSAAYLQRTLSEYFRVPIRVEQFVGKWYDVPPDQLSVLGDVNVTLGATALVGERVWQRDMRAR
LVVGPLTKRDYEAFLPGEERAIALERMLTLLAGVTLEYEVSLVLRRAEVGASVLGAGARLGWDAFLCTRE
AGRDRADARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|386860126|ref|NC_017831.1|:183118-184218 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGCAAACCGCGCAGCGGCGAATCGATCCTGGCGTAGTCGAGCGGCTGCTCGACGAGCCGCATCGCTTCG
AGTTCTTTCAGGCGGTGCGGCTGCTCGAGACCTGGTTCGCGAAGCACGATGCGCCGCGCCACGCGGCGAG
CCGGCCGGGCGAGATCGTCGCGCGGCGCATCGGCTTTCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAGCGCGCGCAGTCGTACGACGCAGCCGGCGCCGCGCTGAAGGACGACGTGCGGCGCAACGCGG
CGCTCGAGGCGGGCGCGCTGTCGCGCGTCGAGCTCACGCCGGCGTTCTTCGGGCTGCTGGGCGGCCAGGG
CGCGCTGCCGCTGCATTACACCGAGCAGATCATCGCGCGTGAGCAACTGAAGCGCGACCATGCCGCGCAC
GCATTCTTCGATGTCTTCTCGAACCGCGCGACCGCGCTGTTCTATTCGGCATGGAAGAAGTACCGTCTGC
CGCTGCATTACGAACTCGACCGCGACGAGCGCTATCTGCCGCTCCTGCTCGCACTCGCGGGCGTGTCGAA
CGACGACGCGCGCTCGACCGTGCAGCAGGGCCGCGGCGCGCTGCTCGACGAGGCGATCGCGGGCTATGCG
CTCGCCGCGCGGCATCGGCCGGTATCGGCCGCGTATCTGCAGCGCACGCTGTCCGAATATTTTCGCGTGC
CGATCCGCGTCGAGCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAATTGAGCGTGCTCGGCGA
CGTGAACGTGACGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGG
CTCGTCGTCGGCCCGCTGACGAAGCGCGACTACGAGGCGTTCCTGCCCGGCGAGGAGCGCGCGATCGCGC
TCGAGCGGATGCTGACGCTGCTCGCGGGCGTGACGCTCGAATACGAGGTGTCGCTCGTGCTGCGCCGCGC
GGAAGTCGGCGCGAGCGTGCTCGGCGCGGGCGCGCGGCTCGGCTGGGACGCGTTTCTCTGCACGCGCGAA
GCCGGGCGCGACCGTGCGGACGCGCGCTACGAGCTGCATGTCATTCATTGA