SecReT6
Protein ID: 386860314
SecReT6 ID642
T6SS typei4b
Gene symboltssA-1
Locus tagBP1026B_I0194
StrainBurkholderia pseudomallei 1026b
Repliconchromosome I [GenBank: NC_017831] [Browse all T6SS(s) in this replicon]
Location [Strand]187011..188132 [+]
Producttype VI secretion system
NoteTssA
UniProt IDI1WF21
KEGG IDbpz:BP1026B_I0194
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|386860314|ref|YP_006273263.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MPTNLTELLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWGFVVEQASALLRER
TKDLRLAVWLTEALAIEDGIGGLTQGYTLLTSLCRQFWDHVHPLPDGDDAEYRLGNVAWLAGRTVELLRA
VPLTDGAANAFSELDWDVAQHVAQAIRRDPEQASEIARGKPSVEQIEASKRMTPVAFYARLLGELKAFQA
ALDALEQELDGRAGDAAPSFRQARDAYETVYRLAERFAKEQGYSADAQPQAVAPPAPSERAEPSFKTPLH
SEEPVPRHAHAPSAPAPIVIAGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQWLAS
VVKDDGSLAHIRELLGLKPDDNA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|386860126|ref|NC_017831.1|:187011-188132 Burkholderia pseudomallei 1026b chromosome 1, complete sequence
ATGCCGACCAACCTCACCGAGCTGCTGACGCCGATCAGCGAAGCGTCGCCGTGCGGCGACGATCTCCTGT
TCTCCGCCGAATTCGACGCGATCCAGCACGCGCGCAAGTTCGACGATCCGTCGCTCGACCAGGGCGAATG
GATCACCGATATCAAGGAAGCGGACTGGGGCTTCGTCGTCGAGCAAGCGAGCGCGCTGTTGCGCGAGCGC
ACGAAGGATCTGCGGCTCGCGGTATGGCTGACCGAGGCGCTCGCGATCGAGGACGGCATCGGTGGGCTCA
CGCAGGGCTACACGCTGCTCACGAGCCTCTGCCGGCAGTTCTGGGACCACGTGCATCCGCTGCCCGACGG
CGACGACGCCGAATACCGGCTCGGCAACGTCGCGTGGCTCGCCGGGCGCACGGTCGAGCTGCTGCGCGCG
GTGCCGCTCACCGACGGCGCGGCGAATGCGTTCAGCGAGCTCGACTGGGACGTCGCGCAACACGTCGCGC
AGGCGATCCGGCGCGATCCCGAACAGGCGAGCGAGATCGCGCGCGGCAAGCCGTCCGTCGAGCAGATCGA
GGCGTCGAAGCGGATGACGCCCGTGGCGTTCTACGCGCGGCTGCTCGGCGAGCTGAAAGCGTTCCAGGCG
GCGCTCGACGCGCTCGAGCAGGAACTCGACGGGCGGGCGGGCGACGCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTACGAAACCGTCTACCGGCTCGCCGAACGCTTCGCGAAGGAGCAGGGCTACTCGGCCGACGC
GCAGCCGCAGGCCGTCGCGCCGCCCGCGCCGAGCGAGCGCGCGGAGCCGAGCTTCAAGACGCCGCTTCAT
TCGGAGGAACCCGTGCCGAGACACGCACACGCGCCGTCCGCGCCCGCGCCGATCGTGATCGCCGGCATTC
AGAATCGCGCGCAGGCCGTCGAGCAACTGCGCGCGGTCGCGAAATATTTCCGCGGAACCGAGCCGCACAG
CCCCGTCGCGTATCTCGCCGACAAGGCGGCCGAATGGGCGGACATGCCGCTGCATCAATGGCTTGCGTCG
GTCGTCAAGGACGACGGCTCGCTCGCGCATATCCGCGAGCTGCTCGGCCTGAAGCCGGACGATAACGCGT
GA