SecReT6
Protein ID: 386863836
SecReT6 ID644
T6SS typei3
Gene symboltssL-2a
Locus tagBP1026B_II0103
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]114779..115468 [+]
Producttype VI secretion system
NoteTssL
UniProt IDI1WQ42
KEGG IDbpz:BP1026B_II0103
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-30, Aligned region: 8..205
Protein Sequence: 229 a.a.     [Download]
>gi|386863836|ref|YP_006276784.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSIEMPAQPLRMLLQDTMLHVALLTQGARISRVHDWRARCIALVRQFEQALQDGGYRGGIANELGLAQCV
FLDEITMRNLSPEQKEEWLRELLQFRFHSIRDGLSKVRARIDRLCRGHSANAALLEMYSLFHEFGLLGDK
QGHALADARVSEARPTPGKKAVETAEVWKDGGAANEAAHGRSWRIVGGLLAFAALMTMWLVIDTRLSHEV
EQMEVTSGDEAAIHPASGD
 
Nucleotide Sequence: 690 bp     [Download]
>gi|386863735|ref|NC_017832.1|:114779-115468 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGTCGATTGAAATGCCCGCGCAGCCGCTGCGCATGTTATTGCAGGACACGATGCTCCATGTCGCGCTAT
TGACGCAAGGCGCGCGCATATCGCGCGTGCATGACTGGCGCGCGCGCTGCATCGCGCTCGTCAGGCAATT
CGAGCAGGCGCTGCAGGACGGCGGCTACCGCGGCGGTATTGCCAATGAATTGGGCCTCGCGCAATGCGTC
TTTCTGGACGAGATCACGATGCGCAATCTGTCGCCCGAGCAAAAGGAAGAATGGTTGCGTGAGCTCCTTC
AGTTCCGTTTCCACTCGATTCGGGATGGGTTGAGCAAAGTGCGTGCGCGTATCGATCGCCTTTGCCGCGG
GCATTCGGCGAATGCCGCATTGCTGGAAATGTATTCGTTGTTCCATGAATTCGGTCTCCTGGGAGACAAG
CAAGGGCACGCGTTAGCCGACGCGCGGGTGTCGGAGGCAAGGCCGACGCCCGGAAAGAAAGCCGTGGAAA
CGGCGGAGGTTTGGAAAGACGGGGGGGCCGCCAATGAAGCGGCGCACGGACGCTCTTGGCGAATCGTCGG
CGGCCTGCTGGCGTTTGCGGCGCTCATGACGATGTGGCTCGTTATCGATACACGTCTGAGCCATGAAGTG
GAACAGATGGAAGTCACGTCCGGAGATGAAGCAGCGATTCATCCGGCATCGGGGGATTGA