SecReT6
Protein ID: 386863838
SecReT6 ID644
T6SS typei3
Gene symboltssB-2
Locus tagBP1026B_II0105
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]117537..118076 [+]
Producttype VI secretion system
NoteTssB
UniProt IDI1WQ44
KEGG IDbpz:BP1026B_II0105
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.50E-61, Aligned region: 11..163
Protein Sequence: 179 a.a.     [Download]
>gi|386863838|ref|YP_006276786.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MAISNSSQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLEPLPAVGDRKFFSIDIDNF
DERMKAMKPRVAFSVPNTLSGDGQLMVDITFESMDDFSPAAIAKKVDALSQLLDARTQLANLQTYMDGKS
GAENLVSKVLKDPALLSALAKAPKPVAEQAENRESKEKH
 
Nucleotide Sequence: 540 bp     [Download]
>gi|386863735|ref|NC_017832.1|:117537-118076 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGCTATATCCAATAGCTCACAGAAATTTATCGCGCGCAATCGTGCGCCTCGCGTTCAGATCGAATACG
ACGTCGAGATTTACGGTTCCGAAAAGAAGGTCGAGCTTCCGTTCGTGATGGGCGTGCTCGCGGACCTGTC
GGGCAAGCCGCTCGAGCCTCTGCCGGCGGTCGGCGACCGCAAGTTCTTCAGCATCGATATCGACAATTTC
GACGAGCGCATGAAGGCGATGAAGCCGCGTGTCGCGTTCTCGGTGCCGAATACTCTTTCCGGCGACGGTC
AATTGATGGTCGACATCACGTTCGAAAGCATGGACGACTTTTCTCCCGCGGCGATCGCGAAGAAGGTGGA
TGCGTTGTCGCAATTGCTGGACGCGCGCACGCAGCTTGCCAATCTGCAGACCTACATGGACGGAAAGTCG
GGCGCGGAGAACCTCGTGAGCAAGGTGCTCAAGGACCCCGCGCTGCTGAGCGCGCTTGCGAAGGCGCCGA
AGCCCGTGGCGGAACAGGCGGAAAACAGGGAATCGAAGGAAAAGCACTGA