SecReT6
Protein ID: 386863840
SecReT6 ID644
T6SS typei3
Gene symbolhcp-2
Locus tagBP1026B_II0107
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]119809..120291 [+]
Producttype VI secretion system
NoteTssD
UniProt IDI1WQ46
KEGG IDbpz:BP1026B_II0107
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-41, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|386863840|ref|YP_006276788.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSGGGAGKATIDDLQFEHYIDRASPNLV
QYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDVLVTQVSPAGVAQDESRPRELVRLSFSRLKQEYVVQN
PQGGSGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|386863735|ref|NC_017832.1|:119809-120291 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGTCGCACGACATTTTCCTCAAGATCAACGGTATCGATGGCGAGGCGGAAGACGCAACCCACAAGGGCG
AAATCGAGGTCTTGAGCTGGTCGTGGAACGTCAGTCAGCAATCGAACATGCACCTGGGTTCGGGGGGCGG
CGCGGGCAAGGCGACGATCGATGATCTGCAGTTCGAACATTACATCGATCGCGCGAGCCCGAATCTCGTT
CAATACTGCTTGCTCGGCAAGCATATCGACGAAGCCCGGCTCGTGGTGCGTAAGGCGGGCGGCAGCCCGC
TCGAATACATCAAGCTCACGATGAGCGATGTGCTCGTTACGCAGGTGAGCCCGGCAGGCGTGGCTCAGGA
CGAATCGCGCCCGCGTGAGCTCGTTCGGCTGTCGTTCTCGCGCCTGAAGCAAGAGTATGTCGTCCAGAAC
CCGCAGGGCGGCAGCGGCGGCGCAATCACCGCGACTTTCGACATCAAGAAGAACGCGGCGTAA