SecReT6
Protein ID: 386863841
SecReT6 ID644
T6SS typei3
Gene symboltssJ-2
Locus tagBP1026B_II0108
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]120419..120961 [+]
Producttype VI secretion system
NoteTssJ
UniProt IDI1WQ47
KEGG IDbpz:BP1026B_II0108
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-36, Aligned region: 26..174
Protein Sequence: 180 a.a.     [Download]
>gi|386863841|ref|YP_006276789.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MAFPFFFRREAARRTAVKRVVAAMVCASLAACASLPARKETADLIVKIKVSEGANPDEHQRPAPVMVRLY
ELKSAGAFENADFFTLQSDSRKVLGDDAIATDEFVMRPGDTRDIHRRADSAGTSVGVLVGYRELGKSVWR
AVHKLRPAPEDAWYRAFTPRTKIKLNVDVGQQTVTITELE
 
Nucleotide Sequence: 543 bp     [Download]
>gi|386863735|ref|NC_017832.1|:120419-120961 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGCTTTCCCATTTTTCTTTCGCCGCGAAGCGGCCAGGCGAACCGCCGTCAAGCGCGTTGTGGCGGCAA
TGGTATGCGCATCGCTCGCGGCTTGCGCAAGCTTGCCGGCACGCAAGGAAACAGCCGATCTGATCGTGAA
GATCAAGGTGAGCGAAGGCGCCAATCCGGATGAGCATCAGCGCCCGGCGCCCGTGATGGTGCGGCTGTAC
GAGCTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTACAGAGCGACAGCCGCAAGGTGT
TGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGCCCGGGCGACACCCGGGATATTCATCGGCG
TGCCGATTCCGCGGGGACGTCGGTCGGCGTGCTGGTCGGTTATCGAGAGCTCGGCAAATCGGTGTGGCGG
GCGGTCCATAAGCTGCGGCCGGCTCCGGAAGATGCATGGTACCGGGCATTCACGCCAAGGACGAAAATCA
AGTTGAACGTCGATGTCGGGCAGCAGACGGTGACGATTACAGAATTGGAATGA