SecReT6
Protein ID: 386863842
SecReT6 ID644
T6SS typei3
Gene symboltssK-2
Locus tagBP1026B_II0109
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]120967..122316 [+]
Producttype VI secretion system
NoteTssK
UniProt IDI1WQ48
KEGG IDbpz:BP1026B_II0109
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|386863842|ref|YP_006276790.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKLVFKSGAGIFP
DGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQAGSLARYSAFEIELRDSNAIGQG
PKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQLHGL
AKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFV
RPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYSSLV
LAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGPFWE
QIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|386863735|ref|NC_017832.1|:120967-122316 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAGTTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCTTCCCCAGCTGTTTCAACAACAGG
AACGGTATTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGCCCGTTTTTCTGGGGATTCAGCCG
ATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCAAGAGCGGTGCGGGAATATTTCCC
GACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCCGCTGACGATTGCCGCCGAGCATC
AGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTGCCGAATACGGAGGAGACCGCGTTCGACGAACA
AGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCGACAGCAATGCGATCGGTCAAGGG
CCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGAAAAGGAGCTGACGCAGTCCTGGA
TCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGCTCGGTCGCGCTGTACGACGGTGACCA
CATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAATGGGCGACCCAGTTGCACGGCCTC
GCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGATGGCCGGGCCGGGGCGGCGGCCG
AGGTGGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAGCCGCTGCTCGAGCACATCTGCAGGAT
TCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGGCAGGCGAATTGTCGACGTTCGTG
CGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGCGCAGTTGTATGCGAGCATTCGCC
CGCTGGTCGACGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGAGGCGCGCAGCCGATCCCGCTCAC
CGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAACTCGCGGGCTATTCGAGCCTCGTG
CTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTTCGCATCCCAAACGAAGATCAGCC
ATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATGACGATGATTCCGTTGCCGGTGCC
TCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTATCCCGCACGGGGCCGTTCTGGGAA
CAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTTCCCTGAACTCAAGCTCGAACTTT
GGGGAGTGCGTCACAAATGA