SecReT6
Protein ID: 386863843
SecReT6 ID644
T6SS typei3
Gene symboltssL-2b
Locus tagBP1026B_II0110
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]122313..123614 [+]
Producttype VI secretion system
NoteTssL
UniProt IDI1WQ49
KEGG IDbpz:BP1026B_II0110
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.30E-61, Aligned region: 62..268
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 21..36
OmpA [PF00691], Evalue: 6.50E-18, Aligned region: 327..425
Protein Sequence: 433 a.a.     [Download]
>gi|386863843|ref|YP_006276791.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MNSGAFDEAAFDFLVSDEGGANVAADRARSAAKAAGAEPARDRIDASVNVQHRLDEVRAAANPLLEAATP
LLRMLADMPATLDTSEAVASLRTLLVREVALFQNLCEKADLPWKHMAVVRYCLCTALDEAANRTRWGGGG
VWASQSLLITYEGEVDGGEKFFLLIGRMATDPQEYVDILEILYRVLGLGFEGRYSVVADGRRHLEQIRQR
LWTLITGARDAIQPELSLRWRGAEPGRLPLLRSVPAWASGALVFLLLFGLFAFYQYRLLTERNALEARIL
AIAKDEPAPPPQRLRLSILLKNEIARGLLTVDEDDRRSVVVFRGDSMFRSGESRVLPEIEPVLDKVAREV
ARVGGRVTVTGHSDNQPIRRADIPNNLVLSEKRAAYVAQILVQRGTPADRIRSEGRGDAQPVAENATPAG
RSRNRRVEIAVTL
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|386863735|ref|NC_017832.1|:122313-123614 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAATTCGGGCGCCTTTGACGAAGCCGCGTTCGATTTTCTCGTATCGGACGAAGGCGGAGCGAACGTCG
CGGCCGATCGCGCGCGATCGGCCGCGAAGGCCGCGGGCGCGGAGCCGGCGCGCGATCGGATCGACGCGTC
GGTCAACGTCCAGCATCGCCTCGACGAAGTTCGCGCGGCGGCCAATCCGCTGCTCGAAGCCGCGACGCCT
TTGCTGCGGATGCTGGCGGACATGCCTGCGACGCTAGACACCTCCGAAGCCGTCGCGAGCCTTCGCACGC
TGCTCGTGCGAGAGGTCGCGCTGTTCCAGAACTTGTGCGAGAAGGCCGATTTGCCTTGGAAGCACATGGC
GGTCGTGCGTTATTGCCTGTGCACGGCACTGGACGAGGCGGCCAATCGCACGCGCTGGGGCGGCGGCGGC
GTATGGGCTTCGCAGAGCTTGCTGATTACATACGAAGGCGAGGTCGACGGAGGCGAGAAGTTCTTCCTGT
TGATCGGACGCATGGCGACGGATCCTCAGGAGTACGTCGATATTCTCGAGATTCTCTATCGCGTGCTGGG
TCTCGGGTTCGAAGGGCGCTACAGCGTCGTTGCGGACGGCCGGCGGCATCTCGAGCAGATTCGCCAGCGT
TTGTGGACGCTCATCACCGGCGCGCGCGACGCGATTCAGCCGGAATTGTCGCTGCGCTGGCGCGGAGCGG
AGCCGGGCAGGCTTCCGCTATTGCGCAGCGTGCCCGCATGGGCGAGCGGTGCGCTCGTCTTCCTGCTGTT
GTTCGGTCTCTTCGCGTTCTATCAGTATCGGTTGCTCACCGAACGCAATGCGCTCGAGGCGCGCATCCTG
GCGATCGCGAAGGACGAGCCGGCGCCGCCACCGCAGCGTTTGCGCCTGTCGATCCTGCTCAAGAACGAAA
TTGCGCGCGGTCTACTGACGGTCGACGAAGACGATAGGCGCAGCGTGGTCGTGTTCCGTGGCGATTCGAT
GTTCCGCTCCGGCGAGAGCCGCGTGCTTCCCGAGATCGAGCCGGTGCTCGACAAGGTGGCGCGGGAAGTG
GCCCGCGTCGGCGGCCGGGTCACGGTCACGGGGCACTCCGACAACCAGCCGATTCGGCGCGCCGACATCC
CGAACAACCTCGTGTTGTCGGAAAAACGCGCGGCTTACGTCGCGCAAATCCTGGTCCAGCGAGGCACTCC
GGCCGATCGTATTCGCTCGGAGGGCCGGGGCGACGCGCAGCCCGTCGCGGAAAACGCGACGCCTGCTGGC
CGATCCCGCAACCGCCGCGTCGAAATCGCGGTCACGCTGTAA