SecReT6
Protein ID: 386863846
SecReT6 ID644
T6SS typei3
Gene symbolvgrG-2
Locus tagBP1026B_II0113
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]128394..131000 [+]
Producttype VI secretion system
NoteTssI
UniProt IDI1WQ52
KEGG IDbpz:BP1026B_II0113
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.20E-78, Aligned region: 41..368
Phage_base_V [PF04717], Evalue: 8.00E-25, Aligned region: 408..501
Gp5_C [PF06715], Evalue: 0.0028, Aligned region: 552..572
Gp5_C [PF06715], Evalue: 0.0028, Aligned region: 585..601
Gp5_C [PF06715], Evalue: 0.0028, Aligned region: 593..614
Gp5_C [PF06715], Evalue: 0.0028, Aligned region: 613..630
Gp5_C [PF06715], Evalue: 0.0028, Aligned region: 618..637
Protein Sequence: 868 a.a.     [Download]
>gi|386863846|ref|YP_006276794.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLD
LKAMIGTEMTVCIQLDGIGTGAQGGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYK
IFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFF
EHSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLAS
LVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHK
HDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGS
LYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGAN
FSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVG
GAYALTVGGVLSIVCGASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGG
AIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTSSEI
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|386863735|ref|NC_017832.1|:128394-131000 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGCCAAACCATTTTTCGAACGGACGGACGAATCAAAGCCGCACGGTAGTGATCCGCAGCGGTGCGATGC
CGCGGCTGCTCGGTCAGCCCGCGCTCGAGTTCCTGTCGCTGCGCGGTGAAGAGCACCTCGGAAAACTCTA
CACGTACGAATTGCTCCTGCGCACGCCGGACGATTTTCATGTGCCGTTGGCAACGAGCGCGAATCTCGAC
CTGAAGGCGATGATCGGCACGGAGATGACGGTCTGCATTCAGCTCGACGGAATCGGGACGGGCGCGCAAG
GCGGCGTTGGCGCGGGTGCGCGCGAAATCAGCGGGCTCGTGGTCAAGGCGGGCTTCCTGCGCTGCGAGGG
GCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGGCTGTGGCTCGCGACTTTGACGAGCGACTACAAG
ATTTTTCAGGACAAGAGCGTCGTCGAAATCATCGATACGGTCTTGCACGATTACCCTTACCCGGTCGAGA
AGCGGCTCGACATCGACAAGTATTCGGTGGCGGGCGAGAGCGCTCGAAACGAGCCGCGCGCGTTCCAGGT
GCAATATGGCGAAACCGACTTCGACTTCGTTCAGCGTTTGATGGAGGAGTGGGGGATCTACTGGTTCTTC
GAGCATTCGGACAACAAGCATCGCCTGGTCTTGTGCGATCACATCGGCGGACATCGCAAGGCGCCGAGCG
AGGCCTATCACGAGATCGCGCATCACCCGGAAGGCGGGAAGATCGACATCGAGTACATCAACTATTTCTC
GACGGACGAAGCGCTGCGGCCCGGCCGCGTCGTGATAGACGATTTCGACTTCACGCGTCCGCTCGCGAGC
CTCGTCACGTCCAATCACCAGCCGCGGGAGACGAACTGGGGGGAGGGCGAGCTGTTCGAATGGCCGGGCG
ACTATACCGATAGCAAGCATGGCGATCTCATCAGCCGCGTGCGCATGGAAGAGCGCCGCGCGACCGGGTC
GCGCGCATACGGTCGGGGCAACGTGCGCGGCCTCGCCTGCGGTCATACGTTCGTGCTGTCGAAGCACAAG
CACGACGGCGCGAACCGCGAGTACCTCGTCATCGAATCGGCGTTGATGCTGACCGAAGTCGCGGACGAAA
CGGGCAGCGGCTACCGCTACGAATGCGATAACGAACTGGTCGTGCAGCCGTCGAACGAGGTGTTTCGAAT
GCCGCGCGAAACGCCCAAGCCGACGACGAGCGGGCCACAGTCCGCGATCGTGGTCGGGCCGCCGGGCCAC
GAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCCGTTTTCTGTGGGATCGCTACGCACGCAATGACG
CAACGGATTCCTGCTGGGTACGCGTGAGCCAGGCGTGGGCCGGCGTGAACTTCGGCGGCATCTACATTCC
GCGGATCGGACAGGAAGTGATCGTCGGATTCATGAACGGCGATCCGGACCGTCCGCTGATTCTCGGCAGC
CTCTACAACACCATTACGCCGCCGCCTTGGGATCTGCCCGGCGACGCGACGAAGAGCGGATTCAAGAGCA
AGTCGATCACGGGCGGGCGCGAGAACTATAACGGCATCCGCTTCGAGGACAAGCTGGGAGCCGAGGAATT
TCACATGCAGGCGGAAAAGGACATGAACCGCCTGACGAAGAACGACGAGTCGCATACGGTCGGCGCGAAT
TTTTCGATCGGCGTCGGGCTTACCCATACGCGCGCGGTGGGCGCCATGTTCAGCAGCATCGTCGGCGGAG
CCGCCAGCTATGCGGTGGGGGGCGCGGAATCGACGATGATCGGCGGCGCGTATGCGTTGAACGTCGGCGG
CGCGCACGCGGTTGCGGTGGGCGGCGCGTCGTCCGTTTCCGTTGGCGGCGCCTACGCGCGCAACGTGGGC
GGCGCGTATGCGCTGACAGTCGGCGGCGTGCTGTCGATCGTCTGCGGTGCGTCTTCGATCACCATGACGG
CTTGCGGCTCGATCAAGATCGTCGGCAAGAATATTCGCATCATCGGCAGCGACGAAGTCGTCGTGCAAGG
CGCGCCCCTGCAACTGAATCCGGGCGATTCGGATTGCGGCGGAGGGGGCGGCGGCGGAGGCGGCGGCGGC
GCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCGATATCACGAAGCCGATTCTTCCGCCGCCGCCGC
CACCACCGACGGAGGTGCCACCGGATCCGACGCCGACGCCCACGCCTACGCCCACGCCGACGCCGACGCC
GACGCCGACGCCGACGCCGACGCCCACGCCCACGCCGACGCCGACGCCGACGCCGACGCCGACGCCAACG
CCAACGCCCACGCCGACGCCGACGCCCACGCCGACGCCGACGCCCACGCCGACGCCCACGCCGACGCCGA
CGCCGACGCCGACGCCGACGCCGACGCCCACGCCGACGCCGACGCCCACGCCCACGCCCACGCCCACGCC
GACGCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCAACGCCAACGCCAACGCCAACGCCAACG
CCGACGCCAACACCAACACCAACACCAACACCAACACCAACACCAACACCAACACCAACACCAACTCCGA
CTAGTTCCGAGATTTAA