SecReT6
Protein ID: 386863852
SecReT6 ID644
T6SS typei3
Gene symboltssG-2
Locus tagBP1026B_II0119
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]138265..139314 [-]
Producttype VI secretion system
NoteTssG
UniProt IDI1WQ58
KEGG IDbpz:BP1026B_II0119
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-98, Aligned region: 29..330
Protein Sequence: 349 a.a.     [Download]
>gi|386863852|ref|YP_006276800.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MTAHPPAARPIDAHSPLHPDALRAWFDPQAPWRAGFLSLLRAIAARDTRMPLPGTACLPKEEAFRIGQRP
SMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGPLPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALF
YRAWASSQATVSLDRAEHETFSFYIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHY
FGVPIAVDEYVFHWIRIAPPERCLLGARAASTVMGEGALLGDMVADCQHKFRLVIGPLDLDQYLRLTPHG
NDLPTLVDWVRAFVGHEYDWEIKLLVKPRAAPPARADTTHRLGYSTWLGESRDDRPVVGMVFEPEKYCS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c139314-138265 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGACGGCGCATCCGCCCGCCGCCCGGCCCATCGACGCCCACTCGCCCCTGCATCCGGACGCACTGCGGG
CATGGTTCGATCCGCAAGCGCCGTGGCGCGCCGGCTTTCTGAGCCTGTTGCGCGCAATCGCCGCACGCGA
CACGCGCATGCCCTTGCCCGGAACGGCGTGTCTGCCGAAGGAAGAGGCGTTTCGCATCGGACAACGGCCG
TCGATGGCCTTCGCGCCGCGCGAGATCGCATCGCTCGACGTGCAGCGCGGGCGTCTCGACATTCAGCTGT
TCGGCCTCGGCCTATGGGGGCCGCAGGGGCCGTTGCCGCTTCACATGACCGAGCTCGCGTACAACCGCGC
CGAGAGCTATCAGGATCATGCGATCGCGCATTTCTCCAATCTCTTTCACCATCGTGCGCTCGCGTTGTTC
TATCGTGCGTGGGCGTCGTCACAGGCGACCGTATCGCTCGATCGCGCCGAGCACGAAACGTTCTCGTTCT
ATATCGGCAGCCTGATGGGCACCGATCCCGAAGAAGCCGCGCGCACGCACCCGCCCACGCACGCGCGGTA
CGCCGCATGCGCGCATCTCGTGCGCGAGGCGCGCAATCCGGACGGCGTGGCCGCCACGCTGTCGCATTAC
TTCGGCGTGCCGATCGCCGTCGACGAATACGTCTTCCACTGGATCCGGATTGCGCCGCCGGAGCGTTGCC
TGCTCGGCGCGCGCGCCGCATCGACCGTCATGGGCGAGGGCGCGCTGCTCGGCGACATGGTTGCCGATTG
CCAGCACAAGTTCCGGCTCGTCATCGGCCCGCTCGATCTCGACCAATATCTTCGCCTGACGCCGCACGGC
AACGATCTGCCGACCCTGGTCGATTGGGTGCGCGCCTTCGTCGGTCACGAATACGACTGGGAGATCAAGC
TGCTCGTCAAGCCGCGCGCCGCGCCGCCCGCCCGCGCGGATACCACGCACCGCCTCGGCTATTCGACCTG
GCTCGGCGAATCGAGGGACGACAGGCCGGTCGTCGGCATGGTGTTCGAGCCGGAAAAATACTGTTCCTGA