SecReT6
Protein ID: 386863854
SecReT6 ID644
T6SS typei3
Gene symboltssE-2
Locus tagBP1026B_II0121
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]141193..141711 [-]
Producttype VI secretion system
NoteTssE
UniProt IDI1WQ60
KEGG IDbpz:BP1026B_II0121
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-20, Aligned region: 38..148
Protein Sequence: 172 a.a.     [Download]
>gi|386863854|ref|YP_006276802.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRIVQRDLSLLLNTSNLDDEVDARRYPL
VSASVVNYGVPPLAGSYLHDRNRETIERLVRTAIAHFEPRLIADSLAIRPLAAQPGASYNKLTFEISALV
QWSPYPLELRIQSTFDLELNRVTLEKTTLNGN
 
Nucleotide Sequence: 519 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c141711-141193 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGCGGCATCCTGAAGGACGGCATCGGGCCGCCTATCTTCCGTCGCTGCTCGACCGGCTGCAAGACGACG
CGCCGCACGCGCTCAGCGAATCGCCCGATGCCTATGCGCCGAGCGCCGACGAAATGCGCCGCATCGTGCA
GCGAGACCTGAGCCTGTTGCTGAACACCAGCAATCTGGACGACGAGGTGGACGCCCGCCGCTATCCGCTC
GTGTCGGCATCTGTCGTCAACTATGGCGTGCCGCCTTTGGCGGGCAGCTATCTGCACGACCGGAACCGGG
AAACGATCGAGCGCCTCGTGCGCACCGCGATCGCCCACTTCGAGCCGCGCCTCATTGCGGACTCCTTGGC
GATCAGGCCGCTCGCGGCGCAACCGGGCGCCAGCTACAACAAATTGACGTTCGAAATCAGCGCGCTCGTG
CAATGGTCGCCGTATCCGCTGGAGTTGCGCATCCAGAGCACGTTCGACCTCGAATTGAATCGAGTCACGC
TCGAGAAGACGACGCTCAACGGAAATTGA