SecReT6
Protein ID: 386863855
SecReT6 ID644
T6SS typei3
Gene symboltagJ-2
Locus tagBP1026B_II0122
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]141698..142552 [-]
Producttype VI secretion system
NoteTagJ
UniProt IDI1WQ61
KEGG IDbpz:BP1026B_II0122
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 9.50E-44, Aligned region: 155..275
Protein Sequence: 284 a.a.     [Download]
>gi|386863855|ref|YP_006276803.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MTNRSESPQPSDPRDAMLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQT
WAGLEPQGEARAQLHRGLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAA
FHCAPVTRGESAEMGSFAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALM
LDATVLRGYAPTRYSGSENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESD
DAAS
 
Nucleotide Sequence: 855 bp     [Download]
>gi|386863735|ref|NC_017832.1|:c142552-141698 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGACGAATCGATCTGAATCTCCGCAACCCTCCGATCCGCGTGACGCCATGCTGCGCGACGCGCTGCGCG
CCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAGGCGGTCAGAAAGCGGCCATCCGACACGCGGGA
ACGCTGGCTACTGTTTCAGTTGCTTTGCATCGACGGCGCGTGGGAGCGCGCGCTCAAACAGCTGCAAACC
TGGGCCGGGCTCGAGCCGCAGGGCGAGGCGCGCGCGCAACTGCATCGCGGCCTGATCCGATGCGAAATGT
TCCGGGCCGACGTGTTTGCCGGCAAGCGAACGCCGGGGTTCATCGACGCGCAGCCCGCCTGGGTCGACAC
GCTCCTCCAAGCCAATGCGAAGCTCGGCGCCGGCGACGTCGCGGCGGCGGACACGCTGCGCGAAGCCGCG
TTCCACTGCGCCCCTGTCACCCGCGGGGAAAGCGCCGAAATGGGAAGCTTCGCATGGCTTACCGACAGCG
ACACCCGCCTCGGTCCGATCTTTGAAATAGCGGTTGCAGGCGGCTATCGATGGATTCCGTTCGAACAACT
GAAGTCCATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTGGCGACCGGTCACGGCACTCATG
CTCGATGCCACGGTTCTCCGCGGCTATGCACCCACCCGCTATTCGGGATCGGAGAACGGCGCGACCGCGA
TCCGCTTGGCCAGCGAGACGACCTGGCGCGACATCGGCACCACCAACGTCGTGGCGCTCGGACAACGAAC
ATGGACCACCGATCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATGCCGCTTCACGGGCGAAAGCGAC
GATGCGGCATCCTGA