SecReT6
Protein ID: 386864285
SecReT6 ID646
T6SS typei3
Gene symboltssA-4
Locus tagBP1026B_II0572
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]706900..707838 [+]
Producttype VI secretion system
NoteTssA
UniProt IDI1WRE1
KEGG IDbpz:BP1026B_II0572
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.20E-16, Aligned region: 46..104
Protein Sequence: 312 a.a.     [Download]
>gi|386864285|ref|YP_006277233.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MNNDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKKAKDVRVGIWH
LRACIARRGLSGLADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLGWLAGPQFLHQLGSSRFEDRD
ATLNDLIGGRAAAIVEDRDYRLRANTLVHDIQDSLSRIRESIAAAEQELNVSRALDLLSVAASRLTQAQA
GGADGASVESDAPVDAPAGASAPGAQQPMAGPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQ
RMLGAGFEEVMAELYPEAASLVAQLSRPQSSK
 
Nucleotide Sequence: 939 bp     [Download]
>gi|386863735|ref|NC_017832.1|:706900-707838 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGAACAACGATGCACTCCCGGGCCATTCGCCGGATTTGCTGGATTTCGACGAAGACTTTATCAAGATCG
ACGCAGCCATCTGCGAATACGATTCCGTCGGTTACGCGCCGCAACGCAAAGGAGAGAGTGCGTTCCAGTG
GGCGTCCATCGAAACGGGATGCCTCGCTTTGTTGAAGAAGGCGAAGGATGTCCGGGTCGGCATTTGGCAT
CTGCGCGCATGCATCGCGCGGCGCGGGCTGAGCGGGCTGGCAGACGGCGTTCGATCGCTGGCCGATCTGA
TGAGTGCGCCCGTCGAGGAATTGCATCCTCGCGCGCTGCCTGACGAATCGCCCGGCGAAACCCTCCTGAT
TCATCTCGGCTGGCTTGCGGGCCCGCAGTTTCTGCATCAGCTCGGCAGTTCCCGGTTCGAAGACCGGGAC
GCAACCCTCAACGATCTGATCGGCGGGCGCGCCGCGGCGATCGTGGAGGATCGCGACTATCGCCTTAGAG
CGAATACTCTTGTACATGACATTCAGGATTCCTTATCGCGAATTCGGGAATCGATCGCCGCGGCCGAGCA
AGAGCTCAACGTCTCGCGCGCGCTCGACCTGTTGAGCGTCGCGGCGTCTCGGCTCACGCAGGCGCAAGCC
GGCGGCGCGGACGGCGCAAGCGTCGAGAGCGACGCGCCGGTCGATGCGCCGGCCGGCGCGTCCGCGCCCG
GCGCGCAGCAGCCGATGGCGGGGCCGGGCGGCGTGTTGAGGTCGAGACAGGAGGTCGGCGCGGCGCTCGA
TCGGATCGTGGAGTACTTCCGCGTGCACGAGCCGAGCCATCCGGCGCCGATCTTCCTGTCGCGGATTCAA
CGAATGCTGGGGGCGGGTTTCGAGGAAGTGATGGCGGAGCTCTATCCCGAGGCGGCATCTCTCGTGGCCC
AACTGAGCCGGCCGCAGAGTTCCAAGTAA