SecReT6
Protein ID: 386864286
SecReT6 ID646
T6SS typei3
Gene symboltssB-4
Locus tagBP1026B_II0573
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]707872..708420 [+]
Producttype VI secretion system
NoteTssB
UniProt IDI1WRE2
KEGG IDbpz:BP1026B_II0573
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-54, Aligned region: 11..159
Protein Sequence: 182 a.a.     [Download]
>gi|386864286|ref|YP_006277234.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDRRFQEIDVENF
DERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPADVVKRIPELSTLLEARNRLKELLTYMDGK
AAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEGAK
 
Nucleotide Sequence: 549 bp     [Download]
>gi|386863735|ref|NC_017832.1|:707872-708420 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
ATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGATTGAATACG
ACGTGGAGGTGTACGGCTCGCAGAAGAAGGTCGAGCTGCCGTTCGTCGCGGGCGTGATGGCGGACCTGTC
GGGCGACAACGTCGAGCCGCTCGGCCCGGTCGAGGATCGGCGCTTTCAGGAGATCGACGTCGAGAACTTC
GATGAGCGCATGGCGCAGATCGCGCCGTCGCTGAGCTATCACGTGAAGAACGTGCTGACCAACGACGGCA
CGCTGATTCCGATCGATCTGACGTTCACGTCGATGGAATCGTTCGAGCCGGCGGACGTCGTCAAGCGCAT
TCCCGAGCTGTCGACGCTGCTCGAGGCGCGCAACCGGCTGAAGGAGCTGCTGACCTACATGGACGGCAAG
GCGGCGGCCGAGGACGTGATCCAGGAATTGTTGAAGAGCCCGCAGTGGGCGAACGAGGCCGACGCGGCGG
AGCAATCCGGCGGCGCCGGCGAGGGTGGAGACCATCAACCGGAAGAGGGTGCGAAATGA