SecReT6
Protein ID: 386864289
SecReT6 ID646
T6SS typei3
Gene symboltssE-4
Locus tagBP1026B_II0576
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]710679..711110 [+]
Producttype VI secretion system
NoteTssE
UniProt IDI1WRE5
KEGG IDbpz:BP1026B_II0576
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.40E-11, Aligned region: 15..116
Protein Sequence: 143 a.a.     [Download]
>gi|386864289|ref|YP_006277237.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MSDLQLYNKLSKRIRRHSLQEVVADHLVDLMNHAIRGARMRIADDSPAAHSVLNFGCPPMQMAGATKINP
VHAAAHICEVIRRFEPRVDPASTVVKPRTESRKRLAQTIYFDVSMKAREDGAELRASLALDYLSGYFSLA
DDR
 
Nucleotide Sequence: 432 bp     [Download]
>gi|386863735|ref|NC_017832.1|:710679-711110 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGAGCGATCTTCAACTCTACAACAAGCTGTCGAAACGGATTCGTCGCCATTCGCTGCAAGAGGTCGTGG
CCGACCACTTGGTCGATCTGATGAATCACGCGATCCGCGGTGCGCGCATGCGCATCGCGGACGACAGCCC
GGCCGCGCATTCGGTGCTGAACTTCGGTTGTCCGCCGATGCAGATGGCCGGTGCGACGAAGATCAATCCG
GTTCATGCGGCCGCGCATATCTGCGAGGTGATTCGCCGCTTCGAGCCGCGCGTGGACCCTGCCAGCACGG
TGGTCAAGCCGCGCACGGAGAGCCGCAAGCGCCTCGCGCAGACGATTTATTTCGACGTGTCGATGAAGGC
GCGCGAAGACGGAGCCGAACTCAGGGCGAGCCTCGCGCTCGACTATCTGAGTGGTTATTTCAGCCTGGCG
GACGACCGATGA