SecReT6
Protein ID: 386864292
SecReT6 ID646
T6SS typei3
Gene symbolclpV-4
Locus tagBP1026B_II0579
StrainBurkholderia pseudomallei 1026b
Repliconchromosome II [GenBank: NC_017832] [Browse all T6SS(s) in this replicon]
Location [Strand]713975..716845 [+]
Producttype VI secretion system
NoteTssH
UniProt IDI1WRE8
KEGG IDbpz:BP1026B_II0579
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-35, Aligned region: 227..249
AAA_2 [PF07724], Evalue: 2.40E-35, Aligned region: 597..763
AAA [PF00004], Evalue: 1.80E-16, Aligned region: 228..333
AAA [PF00004], Evalue: 1.80E-16, Aligned region: 602..687
AAA_5 [PF07728], Evalue: 1.90E-11, Aligned region: 228..248
AAA_5 [PF07728], Evalue: 1.90E-11, Aligned region: 602..702
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 205..250
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 271..306
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 490..490
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 596..624
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 618..696
AAA_16 [PF13191], Evalue: 2.90E-09, Aligned region: 766..821
ClpB_D2-small [PF10431], Evalue: 1.10E-07, Aligned region: 769..842
ClpB_D2-small [PF10431], Evalue: 1.10E-07, Aligned region: 850..867
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 228..335
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 600..623
AAA_22 [PF13401], Evalue: 1.40E-07, Aligned region: 662..686
Sigma54_activat [PF00158], Evalue: 1.70E-06, Aligned region: 207..248
Sigma54_activat [PF00158], Evalue: 1.70E-06, Aligned region: 602..710
Clp_N [PF02861], Evalue: 1.70E-06, Aligned region: 23..72
Clp_N [PF02861], Evalue: 1.70E-06, Aligned region: 111..129
Zeta_toxin [PF06414], Evalue: 3.60E-06, Aligned region: 222..252
Zeta_toxin [PF06414], Evalue: 3.60E-06, Aligned region: 601..652
AAA_17 [PF13207], Evalue: 4.40E-06, Aligned region: 11..62
AAA_17 [PF13207], Evalue: 4.40E-06, Aligned region: 228..248
AAA_17 [PF13207], Evalue: 4.40E-06, Aligned region: 603..637
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 228..256
NACHT [PF05729], Evalue: 2.30E-05, Aligned region: 601..633
AAA_19 [PF13245], Evalue: 3.10E-05, Aligned region: 225..250
AAA_19 [PF13245], Evalue: 3.10E-05, Aligned region: 600..623
AAA_19 [PF13245], Evalue: 3.10E-05, Aligned region: 831..850
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 222..247
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 602..620
IstB_IS21 [PF01695], Evalue: 4.40E-05, Aligned region: 715..745
AAA_18 [PF13238], Evalue: 6.80E-05, Aligned region: 228..248
AAA_18 [PF13238], Evalue: 6.80E-05, Aligned region: 603..628
SRP54 [PF00448], Evalue: 0.00012, Aligned region: 228..260
SRP54 [PF00448], Evalue: 0.00012, Aligned region: 601..624
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 222..245
AAA_29 [PF13555], Evalue: 0.00018, Aligned region: 600..634
Torsin [PF06309], Evalue: 0.00028, Aligned region: 230..250
Torsin [PF06309], Evalue: 0.00028, Aligned region: 558..624
AAA_25 [PF13481], Evalue: 0.00039, Aligned region: 228..251
AAA_25 [PF13481], Evalue: 0.00039, Aligned region: 597..620
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 206..247
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 280..377
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 601..635
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 229..249
RNA_helicase [PF00910], Evalue: 0.0023, Aligned region: 603..623
DUF815 [PF05673], Evalue: 0.0047, Aligned region: 219..303
DUF815 [PF05673], Evalue: 0.0047, Aligned region: 602..617
Protein Sequence: 956 a.a.     [Download]
>gi|386864292|ref|YP_006277240.1| type VI secretion system [Burkholderia pseudomallei 1026b]
MNRERIFNCLGRTTYAALVDATALGRSRRHAFIDLDHWALCLLQREQSDLARLFELFGSDAGEAKRRMEK
ALDGFDVSGDSLRDISSSLERSVGPAVIWSQIAARAGKVRSGHLLLAWLDEDLTRRWLQQRVPSGITSVA
LDDVVKRYEALAAGWPEADEAPAALDGAALGAQAGEAGADGTGDALAKWATCVTEQAARGELDPVVGRDD
ELRTVIDILSRRRQNNPILVGEAGVGKTAVVEALAQKIHAGAVPPGLVGAQVWALDLARMQAGAGVRGEF
EQRLKSLIDAVIASPAPIILFCDETHTLIGAGGAAGTGDAANLIKPMLARGQLRMVAATTWSEYKQYIEP
DAALVRRFQAVAVDEPSDDAAVDMLRTIAPRFAAHHGVRIVDSALRGAVELSRRYLPARQLPDKAISLLD
TACARVAMSQSCAPAELERLQHQAFAIGQTLDWRASDRRMGVRTPGDEAELEGRQASLAQQAATLETVVD
AQRDEVRAWLARLNDATPQAADGDGAAFAARIGANRWVRPWVDEHVVSEVLAEWTGVPVAQLAQDDAQRV
VELEAALNAGIHGQTGAMRSIAQALQVSHSGLNDPRRPLGVMLLAGPTGTGKSQAAAKLAELLFGGERNL
LQFNMNEFQEAHTVSTLKGAPPGYVGYGKGGRLTEAVRKKPYSVLLLDEFDRAHPDIHEVFYQVFDQGWM
EDGEGRRISFRNCLILLTSNLGEAEIEAACKADPRISQAKLDKLVGERLQGRFSPALLARIQLVAFRTLD
VDALTGIATQALDELGERLAQNDLQWRADEGVASWIAHAVSQHPANGRAVRDLLRQHVMPAVARGVLAAR
AEGRALKTVRLAANEKLSLVFDEDAWELSGTDAASLGEQAQAVAMAREAEAVAAAVAAREAHGAHGTNEA
DGGGGAPHAAKADAHVDSDDERPGGAPHPDETASANAGTTGEPSCV
 
Nucleotide Sequence: 2871 bp     [Download]
>gi|386863735|ref|NC_017832.1|:713975-716845 Burkholderia pseudomallei 1026b chromosome 2, complete sequence
GTGAATCGCGAACGCATATTCAACTGTCTCGGCCGCACGACCTATGCGGCCCTTGTCGATGCGACGGCGC
TGGGCCGATCGCGTCGGCACGCCTTCATCGATCTCGATCACTGGGCGCTGTGCCTGCTGCAGCGCGAGCA
GAGCGATCTCGCGCGGCTGTTCGAGCTGTTCGGCAGCGATGCCGGCGAAGCGAAGCGCCGCATGGAGAAG
GCGCTCGACGGCTTCGACGTGAGCGGCGACTCGCTGCGCGACATCTCCAGCTCGCTGGAGCGCAGCGTGG
GGCCGGCCGTCATCTGGAGCCAGATCGCGGCGCGCGCGGGCAAGGTGCGCTCCGGCCACCTGCTGCTCGC
GTGGCTCGACGAGGATCTGACGCGCCGCTGGCTGCAGCAGCGCGTGCCGAGCGGCATCACGTCGGTGGCG
CTCGACGACGTGGTGAAGCGCTATGAGGCGCTCGCGGCGGGCTGGCCGGAGGCCGACGAGGCGCCGGCCG
CGCTGGACGGCGCGGCGCTGGGCGCGCAGGCGGGCGAAGCCGGCGCAGACGGCACGGGCGACGCGCTCGC
GAAGTGGGCGACGTGCGTGACGGAGCAGGCCGCGCGCGGCGAGCTCGATCCGGTGGTGGGGCGCGACGAC
GAATTGCGCACGGTGATCGACATTCTGTCGCGCCGCCGGCAGAACAACCCGATCCTCGTGGGCGAGGCGG
GGGTGGGCAAGACGGCCGTGGTCGAGGCGCTCGCGCAGAAGATCCACGCGGGCGCGGTGCCGCCGGGGCT
CGTGGGCGCGCAGGTGTGGGCGCTCGACCTGGCGCGGATGCAGGCGGGCGCGGGGGTGCGCGGCGAGTTC
GAGCAGCGCCTGAAATCGCTGATCGACGCGGTGATCGCCTCGCCCGCGCCGATCATCCTGTTCTGCGACG
AGACGCACACGCTGATCGGCGCGGGCGGCGCGGCGGGCACGGGCGACGCGGCCAACCTGATCAAGCCGAT
GCTCGCGCGCGGCCAATTGAGGATGGTCGCGGCGACGACGTGGTCCGAATACAAGCAGTACATCGAGCCG
GACGCGGCGCTCGTGCGGCGCTTCCAGGCGGTCGCGGTCGACGAGCCGAGCGACGATGCGGCGGTCGACA
TGCTGCGCACGATCGCGCCGCGCTTTGCCGCGCACCACGGCGTGCGCATCGTCGATTCGGCGCTGCGCGG
CGCGGTCGAGCTGTCGCGCCGCTATCTGCCCGCGCGGCAGTTGCCGGACAAGGCGATCAGCCTGCTCGAC
ACCGCGTGCGCGCGCGTGGCGATGAGCCAGAGCTGCGCGCCCGCGGAGCTCGAGCGCTTGCAGCACCAGG
CGTTCGCGATCGGCCAGACGCTCGATTGGCGCGCGAGCGACCGGCGCATGGGCGTGCGCACGCCGGGCGA
CGAAGCCGAGCTCGAAGGCCGTCAGGCGAGCCTCGCGCAGCAGGCGGCGACGCTCGAGACGGTCGTGGAC
GCGCAGCGCGACGAGGTGCGTGCGTGGCTCGCGCGGCTGAACGACGCCACGCCGCAGGCGGCCGACGGCG
ACGGCGCCGCGTTCGCCGCGCGCATCGGCGCGAATCGCTGGGTGCGGCCATGGGTCGACGAACACGTGGT
GTCGGAGGTGCTCGCCGAATGGACGGGGGTGCCCGTCGCGCAGCTCGCGCAGGACGACGCGCAGCGCGTG
GTGGAGCTCGAGGCGGCATTGAACGCGGGCATCCACGGGCAGACGGGCGCGATGCGCTCGATCGCGCAGG
CGCTGCAGGTGTCGCACTCGGGGCTGAACGATCCGCGCCGCCCGCTCGGCGTGATGCTGCTCGCGGGGCC
GACGGGCACGGGCAAGAGCCAGGCGGCCGCGAAGCTCGCCGAGCTGCTGTTCGGCGGCGAGCGCAACCTG
CTGCAGTTCAACATGAACGAGTTCCAGGAAGCGCACACGGTGTCGACGCTCAAGGGCGCGCCGCCGGGGT
ACGTCGGCTACGGCAAGGGCGGTCGGCTGACCGAGGCGGTGCGCAAGAAGCCGTACAGCGTGCTGCTGCT
GGACGAATTCGATCGCGCGCATCCGGACATTCATGAGGTGTTCTATCAAGTCTTCGATCAGGGGTGGATG
GAGGACGGCGAAGGCCGCCGGATCAGCTTCCGCAACTGCCTGATCCTGCTGACGAGCAATCTGGGGGAGG
CGGAGATCGAAGCGGCGTGCAAGGCCGATCCGCGGATCTCGCAGGCGAAGCTCGACAAGCTGGTGGGCGA
GCGGCTGCAGGGGCGTTTCTCGCCGGCGCTGCTCGCGCGGATTCAGCTCGTGGCGTTCCGCACGCTCGAT
GTCGACGCGTTGACGGGCATCGCGACGCAGGCGCTGGACGAGCTGGGCGAGCGCCTGGCGCAGAACGATC
TGCAATGGCGCGCGGACGAAGGCGTGGCGTCGTGGATCGCGCATGCGGTGTCGCAGCATCCGGCGAACGG
ACGCGCGGTGCGCGACCTGTTGCGCCAGCACGTGATGCCGGCCGTGGCGCGCGGCGTGCTCGCCGCGCGT
GCGGAAGGGCGAGCGCTGAAGACGGTGCGGCTCGCGGCGAACGAGAAGCTGTCGCTCGTGTTCGACGAGG
ACGCGTGGGAACTGAGCGGCACCGATGCGGCGTCGCTCGGCGAGCAGGCGCAGGCGGTGGCGATGGCGCG
CGAGGCGGAGGCGGTGGCCGCTGCCGTGGCGGCACGCGAAGCGCACGGCGCGCACGGCACGAATGAGGCG
GATGGAGGCGGCGGCGCGCCGCACGCGGCGAAAGCCGATGCGCATGTCGATTCGGATGACGAACGTCCAG
GCGGCGCGCCTCATCCCGATGAAACGGCTTCGGCGAACGCCGGCACGACGGGAGAACCGTCATGCGTCTG
A